PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Eucgr.K00193.2.p | ||||||||
Common Name | EUGRSUZ_K00193 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 172aa MW: 19778.7 Da PI: 10.2879 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 80.3 | 1.3e-25 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rien++ +qvtfskR +g+lKKA+ELSvL +aevaviifs++g+l+e+ss Eucgr.K00193.2.p 10 RIENTTSQQVTFSKRWTGLLKKAYELSVLGNAEVAVIIFSQKGRLHEFSS 59 8***********************************************96 PP | |||||||
2 | K-box | 68.2 | 2.7e-23 | 85 | 171 | 11 | 97 |
K-box 11 eakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 e+ +l+qe + ++++ie L+ ++R+l G++L+s+s+ ++qq+ +qLe+sl +iR++K +l+ +qi++lq ke++l+ee+ +L +k Eucgr.K00193.2.p 85 EQYILRLKQETTDMERKIELLEVSLRKLSGQCLGSCSMDDIQQMGDQLERSLGSIRERKAQLFNDQIQQLQAKERSLKEEKAKLLAK 171 55666899**************************************************************************99865 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 28.217 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.2E-32 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 8.19E-33 | 2 | 79 | No hit | No description |
SuperFamily | SSF55455 | 5.76E-27 | 3 | 76 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.1E-25 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.6E-22 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.1E-25 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.1E-25 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 13.331 | 88 | 171 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 4.6E-21 | 90 | 170 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 172 aa Download sequence Send to blast |
MARGKVQMRR IENTTSQQVT FSKRWTGLLK KAYELSVLGN AEVAVIIFSQ KGRLHEFSSN 60 SEIRKTIDRY RRSTNDAATY QASMEQYILR LKQETTDMER KIELLEVSLR KLSGQCLGSC 120 SMDDIQQMGD QLERSLGSIR ERKAQLFNDQ IQQLQAKERS LKEEKAKLLA K* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Eucgr.K00193.2.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY263808 | 1e-163 | AY263808.1 Eucalyptus grandis SOC1-like floral activator MADS4 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018720707.1 | 1e-121 | PREDICTED: MADS-box protein AGL42-like | ||||
Swissprot | Q9FIS1 | 6e-60 | AGL42_ARATH; MADS-box protein AGL42 | ||||
TrEMBL | A0A058ZWZ0 | 1e-120 | A0A058ZWZ0_EUCGR; Uncharacterized protein | ||||
TrEMBL | A0A058ZX02 | 1e-120 | A0A058ZX02_EUCGR; Uncharacterized protein | ||||
STRING | XP_010035068.1 | 1e-108 | (Eucalyptus grandis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G62165.3 | 2e-57 | AGAMOUS-like 42 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Eucgr.K00193.2.p |