PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Eucgr.K00192.1.p | ||||||||
Common Name | EUGRSUZ_K00192, LOC104424370 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 210aa MW: 24340.9 Da PI: 9.9205 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 93.6 | 9.3e-30 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rien++ rqvtfskRr+g+lKKA+ELSvLCdaeva+iifs++g+lye+ss Eucgr.K00192.1.p 10 RIENTTSRQVTFSKRRTGLLKKAYELSVLCDAEVAMIIFSQKGRLYEFSS 59 8***********************************************96 PP | |||||||
2 | K-box | 66.5 | 9.1e-23 | 89 | 171 | 15 | 97 |
K-box 15 eslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 +l+qe ++++ie L+ ++R+l G+++es+s+ e+qq+ +qLe+sl++iR++K +l+ +qi++lq ke+ l+een +L +k Eucgr.K00192.1.p 89 LHLKQETMDMERKIELLEVSLRKLSGQCVESCSIDEIQQIGNQLERSLSSIRERKAQLFNDQIQQLQAKERFLKEENAKLLAK 171 5899***************************************************************************9877 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 3.6E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 31.973 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.63E-38 | 3 | 76 | No hit | No description |
SuperFamily | SSF55455 | 3.27E-31 | 3 | 75 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.0E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.2E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.0E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.0E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 13.815 | 88 | 178 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 5.5E-21 | 90 | 171 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 210 aa Download sequence Send to blast |
MVRGKVQMRR IENTTSRQVT FSKRRTGLLK KAYELSVLCD AEVAMIIFSQ KGRLYEFSSN 60 SEIRKTIDRY RRYTNDVDMY QAKMEQCILH LKQETMDMER KIELLEVSLR KLSGQCVESC 120 SIDEIQQIGN QLERSLSSIR ERKAQLFNDQ IQQLQAKERF LKEENAKLLA KRYANPWQST 180 AHPRAAAIHS RSSRSTDVET GLFIGLPES* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 5e-18 | 1 | 73 | 1 | 72 | MEF2C |
5f28_B | 5e-18 | 1 | 73 | 1 | 72 | MEF2C |
5f28_C | 5e-18 | 1 | 73 | 1 | 72 | MEF2C |
5f28_D | 5e-18 | 1 | 73 | 1 | 72 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Eucgr.K00192.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY263808 | 0.0 | AY263808.1 Eucalyptus grandis SOC1-like floral activator MADS4 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010035067.1 | 1e-154 | PREDICTED: MADS-box protein AGL42 | ||||
Swissprot | Q9FIS1 | 2e-75 | AGL42_ARATH; MADS-box protein AGL42 | ||||
TrEMBL | A0A058ZY83 | 1e-153 | A0A058ZY83_EUCGR; Uncharacterized protein | ||||
STRING | XP_010035067.1 | 1e-153 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM78 | 28 | 413 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G62165.3 | 1e-77 | AGAMOUS-like 42 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Eucgr.K00192.1.p |
Entrez Gene | 104424370 |