PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Eucgr.J02250.1.p | ||||||||
Common Name | EUGRSUZ_J02250, LOC104422646 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 115aa MW: 13425.4 Da PI: 11.2656 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 97.6 | 1.3e-30 | 17 | 108 | 1 | 92 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 aCa C+v+++kC kdC apyfpa ++++f ++h++FG + ++++l+++p+++r da++slvyeA+ar +dPv+G g + ++ + e+l++ Eucgr.J02250.1.p 17 ACARCRVMKKKCWKDCRWAPYFPAGEHERFTILHRVFGGNMIMEILQQVPNDRRADAIHSLVYEANARENDPVNGRRGQLAQMIAEEERLQV 108 7*****************************************************************************99999888888775 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.240.10 | 1.2E-5 | 8 | 30 | IPR001138 | Zn(2)-C6 fungal-type DNA-binding domain |
PROSITE profile | PS50891 | 19.93 | 16 | 114 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 3.9E-28 | 17 | 107 | IPR004883 | Lateral organ boundaries, LOB |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006357 | Biological Process | regulation of transcription from RNA polymerase II promoter | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0000981 | Molecular Function | RNA polymerase II transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 115 aa Download sequence Send to blast |
MDGGGVRRRR RRRRRRACAR CRVMKKKCWK DCRWAPYFPA GEHERFTILH RVFGGNMIME 60 ILQQVPNDRR ADAIHSLVYE ANARENDPVN GRRGQLAQMI AEEERLQVPH QADG* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 3e-22 | 18 | 107 | 12 | 101 | LOB family transfactor Ramosa2.1 |
5ly0_B | 3e-22 | 18 | 107 | 12 | 101 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 7 | 15 | RRRRRRRRR |
2 | 8 | 15 | RRRRRRRR |
3 | 9 | 15 | RRRRRRR |
4 | 9 | 26 | RRRRRRRACARCRVMKKK |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Eucgr.J02250.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010056712.1 | 3e-31 | PREDICTED: LOB domain-containing protein 4 | ||||
Refseq | XP_010058105.1 | 3e-31 | PREDICTED: LOB domain-containing protein 4 | ||||
TrEMBL | A0A059AGU2 | 3e-78 | A0A059AGU2_EUCGR; Uncharacterized protein | ||||
STRING | XP_010033333.1 | 5e-79 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM35076 | 2 | 2 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G30130.1 | 2e-24 | LBD family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Eucgr.J02250.1.p |
Entrez Gene | 104422646 |