PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Eucgr.J02237.1.p | ||||||||
Common Name | EUGRSUZ_J022372, LOC104422633 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 176aa MW: 19452.8 Da PI: 6.6518 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 139.2 | 1.4e-43 | 11 | 109 | 1 | 99 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 +CaaCk+lrrkC +dC++apyfp e+p+kfanvhk+FGasnv+kll+++ +++red+++sl+yeAear++dPvyG+vg i+ lq+q+ +l++e Eucgr.J02237.1.p 11 PCAACKFLRRKCLPDCIFAPYFPPEEPQKFANVHKIFGASNVSKLLNEVLPHQREDTVNSLAYEAEARLKDPVYGCVGAISVLQRQVIRLQKE 103 7******************************************************************************************** PP DUF260 94 lallke 99 l+++++ Eucgr.J02237.1.p 104 LDATNA 109 *99876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 27.418 | 10 | 111 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 5.0E-43 | 11 | 108 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 176 aa Download sequence Send to blast |
MASSSGYSSS PCAACKFLRR KCLPDCIFAP YFPPEEPQKF ANVHKIFGAS NVSKLLNEVL 60 PHQREDTVNS LAYEAEARLK DPVYGCVGAI SVLQRQVIRL QKELDATNAD LIQYTCREMP 120 STVSRPVHYR RKNNNNMVQV YGDGGFDQNC GGYYHPNAWS NVHDGDGQEG DDGGM* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 3e-65 | 2 | 119 | 2 | 119 | LOB family transfactor Ramosa2.1 |
5ly0_B | 3e-65 | 2 | 119 | 2 | 119 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Eucgr.J02237.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010033314.1 | 1e-131 | PREDICTED: LOB domain-containing protein 25 isoform X1 | ||||
Swissprot | Q9FML4 | 2e-66 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
TrEMBL | A0A059AGJ2 | 1e-130 | A0A059AGJ2_EUCGR; Uncharacterized protein | ||||
STRING | XP_010033314.1 | 1e-131 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM131 | 28 | 340 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G63090.4 | 6e-66 | LBD family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Eucgr.J02237.1.p |
Entrez Gene | 104422633 |
Publications ? help Back to Top | |||
---|---|---|---|
|