PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Eucgr.J00940.1.p | ||||||||
Common Name | EUGRSUZ_J00940 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 233aa MW: 26231.1 Da PI: 10.0456 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 155.6 | 2.1e-48 | 19 | 145 | 2 | 128 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 ppGfrFhPtdeel+v+yLk+kv+++ +++ e i+++d+y+++Pw+Lpkk+ +e ewyfFs+r++ky++g r+nra+ sgyWkatg dk++l+ Eucgr.J00940.1.p 19 PPGFRFHPTDEELLVYYLKNKVASRLVPA-ELIADIDLYQYNPWELPKKAFFGEGEWYFFSPRNRKYPNGGRPNRAAGSGYWKATGIDKPILT 110 9*************************999.89***************87778999*************************************9 PP NAM 95 k.kgelvglkktLvfykgrapkgektdWvmheyrl 128 + +++ +g+kk Lvf+ gr pkg kt+W m+eyrl Eucgr.J00940.1.p 111 SgGTKSIGVKKALVFHIGRPPKGMKTEWSMDEYRL 145 967778***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 4.84E-59 | 16 | 172 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 56.83 | 18 | 172 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.9E-25 | 19 | 145 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 233 aa Download sequence Send to blast |
MDLWVDAAQP ARSFPAAFPP GFRFHPTDEE LLVYYLKNKV ASRLVPAELI ADIDLYQYNP 60 WELPKKAFFG EGEWYFFSPR NRKYPNGGRP NRAAGSGYWK ATGIDKPILT SGGTKSIGVK 120 KALVFHIGRP PKGMKTEWSM DEYRLIDATV RPPRSKRSMR LDDWVLCRVR QKEKVPRNAG 180 SHHGDFSSST KAAPSYPKKN GEALPVHTGL CKEVAMENPF QDCLVMASLL SGQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 9e-67 | 17 | 173 | 16 | 166 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 9e-67 | 17 | 173 | 16 | 166 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 9e-67 | 17 | 173 | 16 | 166 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 9e-67 | 17 | 173 | 16 | 166 | NO APICAL MERISTEM PROTEIN |
3swm_A | 8e-67 | 17 | 173 | 19 | 169 | NAC domain-containing protein 19 |
3swm_B | 8e-67 | 17 | 173 | 19 | 169 | NAC domain-containing protein 19 |
3swm_C | 8e-67 | 17 | 173 | 19 | 169 | NAC domain-containing protein 19 |
3swm_D | 8e-67 | 17 | 173 | 19 | 169 | NAC domain-containing protein 19 |
3swp_A | 8e-67 | 17 | 173 | 19 | 169 | NAC domain-containing protein 19 |
3swp_B | 8e-67 | 17 | 173 | 19 | 169 | NAC domain-containing protein 19 |
3swp_C | 8e-67 | 17 | 173 | 19 | 169 | NAC domain-containing protein 19 |
3swp_D | 8e-67 | 17 | 173 | 19 | 169 | NAC domain-containing protein 19 |
4dul_A | 9e-67 | 17 | 173 | 16 | 166 | NAC domain-containing protein 19 |
4dul_B | 9e-67 | 17 | 173 | 16 | 166 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor of the NAC family associated with male fertility. {ECO:0000250}. | |||||
UniProt | Transcription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence (developmental, light-induced and ABA-induced senescence) and regulates fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. Activates the expression of senescence and ABA associated genes including NCED1, ABCG40, CYP707A2, SAG113, SGR1 and PAO, by directly binding to their promoters. {ECO:0000269|PubMed:29760199}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Eucgr.J00940.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. Induced by abscisic acid (ABA). {ECO:0000269|PubMed:29760199}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010032014.1 | 1e-175 | PREDICTED: NAC domain-containing protein 68 | ||||
Swissprot | A2YMR0 | 1e-71 | NAC10_ORYSI; NAC transcription factor ONAC010 | ||||
Swissprot | K4BNG7 | 5e-72 | NAP2_SOLLC; NAC domain-containing protein 2 | ||||
TrEMBL | A0A059AC48 | 1e-173 | A0A059AC48_EUCGR; Uncharacterized protein (Fragment) | ||||
STRING | XP_010032014.1 | 1e-175 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM17984 | 6 | 7 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G15510.1 | 1e-72 | NAC domain containing protein 2 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Eucgr.J00940.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|