PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Eucgr.J00521.1.p | ||||||||
Common Name | EUGRSUZ_J00521 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 170aa MW: 18876.4 Da PI: 10.2005 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 64.2 | 4e-20 | 3 | 65 | 66 | 128 |
NAM 66 kkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 +++a+g r++r+t+ gyWkatg+ +v+s++++++g+kk++vfy g+ap+g+kt+W ++eyr+ Eucgr.J00521.1.p 3 ERQARGGRPSRSTAVGYWKATGSPCQVYSSENKVIGMKKSMVFYVGKAPTGRKTKWKLNEYRA 65 567899*******************************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 24.656 | 1 | 98 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 9.29E-20 | 4 | 97 | IPR003441 | NAC domain |
Pfam | PF02365 | 4.9E-8 | 9 | 64 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 170 aa Download sequence Send to blast |
MQERQARGGR PSRSTAVGYW KATGSPCQVY SSENKVIGMK KSMVFYVGKA PTGRKTKWKL 60 NEYRAIEIIS PPAPNSSSSS VPMFRLRHEF TLCRVYVVSG SSRAFDRRPL KLVARETIQD 120 GDGGGSSSGE SASPSGSVIE NNVGISHFMK TISMEKEEPI WDWEQFNWF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 1e-16 | 8 | 103 | 86 | 170 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 1e-16 | 8 | 103 | 86 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 1e-16 | 8 | 103 | 86 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 1e-16 | 8 | 103 | 86 | 170 | NO APICAL MERISTEM PROTEIN |
3swm_A | 1e-16 | 8 | 103 | 89 | 173 | NAC domain-containing protein 19 |
3swm_B | 1e-16 | 8 | 103 | 89 | 173 | NAC domain-containing protein 19 |
3swm_C | 1e-16 | 8 | 103 | 89 | 173 | NAC domain-containing protein 19 |
3swm_D | 1e-16 | 8 | 103 | 89 | 173 | NAC domain-containing protein 19 |
3swp_A | 1e-16 | 8 | 103 | 89 | 173 | NAC domain-containing protein 19 |
3swp_B | 1e-16 | 8 | 103 | 89 | 173 | NAC domain-containing protein 19 |
3swp_C | 1e-16 | 8 | 103 | 89 | 173 | NAC domain-containing protein 19 |
3swp_D | 1e-16 | 8 | 103 | 89 | 173 | NAC domain-containing protein 19 |
4dul_A | 1e-16 | 8 | 103 | 86 | 170 | NAC domain-containing protein 19 |
4dul_B | 1e-16 | 8 | 103 | 86 | 170 | NAC domain-containing protein 19 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Eucgr.J00521.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010034224.1 | 1e-85 | PREDICTED: NAC domain-containing protein 90 | ||||
Swissprot | Q9FMR3 | 5e-50 | NAC90_ARATH; NAC domain-containing protein 90 | ||||
TrEMBL | A0A059AAM4 | 1e-121 | A0A059AAM4_EUCGR; Uncharacterized protein | ||||
STRING | XP_010034224.1 | 4e-85 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM1445 | 28 | 93 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G44350.2 | 2e-49 | NAC domain containing protein 61 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Eucgr.J00521.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|