PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.I02094.1.p
Common NameEUGRSUZ_I02094, LOC104419471
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family CO-like
Protein Properties Length: 388aa    MW: 42662.3 Da    PI: 6.1467
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.I02094.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box18.34.8e-062464438
          zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38
                      r+C+++ +   + +C+ +  +lC +C   +H        H+
  Eucgr.I02094.1.p 24 RVCDTCRSAACTVYCRADLAYLCSSCDARIHAAnrvasrHE 64
                      79******99*********************5555666666 PP

2zf-B_box28.14.1e-0966111342
          zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                        ++C+ +e+ ++ + C+ +   lC  C   +H+       H +vp+
  Eucgr.I02094.1.p  66 VWVCEACERAPAAFLCKADAASLCTACDADIHSAnplarrHHRVPI 111
                       689*****************************66899999877775 PP

3CCT70.34.8e-24318361144
               CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                       Rea++lRY+eK+ktRkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  Eucgr.I02094.1.p 318 REARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRT 361
                       9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.1822168IPR000315B-box-type zinc finger
SMARTSM003363.0E-72168IPR000315B-box-type zinc finger
CDDcd000212.54E-72468No hitNo description
PROSITE profilePS5011911.09264111IPR000315B-box-type zinc finger
PfamPF006433.7E-765111IPR000315B-box-type zinc finger
CDDcd000218.96E-967111No hitNo description
SMARTSM003361.2E-869111IPR000315B-box-type zinc finger
PfamPF062037.6E-18318360IPR010402CCT domain
PROSITE profilePS5101716.648318360IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009909Biological Processregulation of flower development
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048576Biological Processpositive regulation of short-day photoperiodism, flowering
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MLKEDTSGSG GSSGSGSGGN SWARVCDTCR SAACTVYCRA DLAYLCSSCD ARIHAANRVA  60
SRHERVWVCE ACERAPAAFL CKADAASLCT ACDADIHSAN PLARRHHRVP ILPISGCLHG  120
PLAGNVGGPV MGHAADTEEG FLAPEDEEAI DEEDDDEAAS WLLINPVKSN NSHTNGFIFG  180
GEVEDYLDLV EYNSGAENQY VDQYNQHQQQ QQQQQQQQQH YGVSRKNYGG DSVVPIQHSD  240
CQRHNFQLNL DYEPSKAANS YTRSLSHTVS ISSMDVGIVP ESTPTDISIS HPRPPKGTID  300
LFSGPPIQMP SQLSPMDREA RVLRYREKKK TRKFEKTIRY ASRKAYAETR PRIKGRFAKR  360
TDVDIEVDQM FSATLMTENA YGIVPSF*
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. Does not affect flowering time.
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.I02094.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Expressed with a circadian rhythm showing a peak at dawn.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010029446.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 2
SwissprotQ965021e-146COL2_ARATH; Zinc finger protein CONSTANS-LIKE 2
TrEMBLA0A059ARP70.0A0A059ARP7_EUCGR; Uncharacterized protein
STRINGXP_010029446.10.0(Eucalyptus grandis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21282670
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.11e-128CONSTANS-like 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Simon S,Rühl M,de Montaigu A,Wötzel S,Coupland G
    Evolution of CONSTANS Regulation and Function after Gene Duplication Produced a Photoperiodic Flowering Switch in the Brassicaceae.
    Mol. Biol. Evol., 2015. 32(9): p. 2284-301
    [PMID:25972346]