PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Eucgr.I00098.1.p

Common Name

EUGRSUZ_I00098

Organism

Eucalyptus grandis

Taxonomic ID

71139

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus

Family

NAC

Protein Properties

Length: 105aa MW: 12351.2 Da PI: 8.3293

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Eucgr.I00098.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	56	1.3e-17	44	92	1	50
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkk 50 lp+GfrFhPtdeelv++yL +k+++ ++++ +i+e+d+yk++PwdLp + Eucgr.I00098.1.p 44 LPAGFRFHPTDEELVSDYLIRKCASLPISA-PIIAEIDLYKFDPWDLPGT 92 799***********************99.88************943 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	7.06E-20	38	93	IPR003441	NAC domain
PROSITE profile	PS51005	19.975	44	104	IPR003441	NAC domain
Pfam	PF02365	3.0E-7	45	87	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 105 aa Download sequence Send to blast
SRVEQVQGLV EKGTDQRVSR RRRTESREER EREREKMKKA QMELPAGFRF HPTDEELVSD 60 YLIRKCASLP ISAPIIAEID LYKFDPWDLP GTFRPFLCFF RLCC*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	3e-20	34	90	5	61	Stress-induced transcription factor NAC1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	May be involved in regulation of seed germination under flooding. {ECO:0000269\|PubMed:19176720}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Eucgr.I00098.1.p

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By low-oxygen stress. {ECO:0000269\|PubMed:19176720}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010027536.1	3e-31	PREDICTED: NAC domain-containing protein 2 isoform X1
Refseq	XP_010027538.1	2e-31	PREDICTED: NAC domain-containing protein 2 isoform X2
Swissprot	Q8H115	5e-22	NA102_ARATH; NAC domain-containing protein 102
TrEMBL	A0A059AK49	1e-69	A0A059AK49_EUCGR; Uncharacterized protein (Fragment)
STRING	XP_010027536.1	1e-30	(Eucalyptus grandis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM7967	13	40

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G63790.1	9e-25	NAC domain containing protein 102

Link Out ? help Back to Top
Phytozome	Eucgr.I00098.1.p

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Takasaki H, et al. SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence. Plant J., 2015. 84(6): p. 1114-23 [PMID:26518251] Song L, et al. A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239] Li B, et al. Network-Guided Discovery of Extensive Epistasis between Transcription Factors Involved in Aliphatic Glucosinolate Biosynthesis. Plant Cell, 2018. 30(1): p. 178-195 [PMID:29317470]