PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Eucgr.H02544.1.p | ||||||||
Common Name | EUGRSUZ_H02544 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | TALE | ||||||||
Protein Properties | Length: 182aa MW: 21140.1 Da PI: 8.6305 | ||||||||
Description | TALE family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 30.6 | 5.6e-10 | 128 | 162 | 21 | 55 |
HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 k +yp+++++ LAk++gL+++q+ +WF N+R ++ Eucgr.H02544.1.p 128 KWPYPTEADKIALAKSTGLDQKQINNWFINQRKRH 162 579*****************************885 PP | |||||||
2 | ELK | 28.8 | 2.8e-10 | 82 | 103 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 +LK++LlrK++ ++++Lk EFs Eucgr.H02544.1.p 82 DLKDRLLRKFGNHISTLKLEFS 103 69*******************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03789 | 1.0E-6 | 82 | 103 | IPR005539 | ELK domain |
PROSITE profile | PS51213 | 9.638 | 82 | 102 | IPR005539 | ELK domain |
SMART | SM01188 | 6.9E-5 | 82 | 103 | IPR005539 | ELK domain |
PROSITE profile | PS50071 | 12.762 | 102 | 165 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 1.71E-19 | 103 | 175 | IPR009057 | Homeodomain-like |
SMART | SM00389 | 1.2E-13 | 104 | 169 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 4.9E-28 | 107 | 166 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 2.44E-12 | 114 | 166 | No hit | No description |
Pfam | PF05920 | 2.3E-17 | 122 | 161 | IPR008422 | Homeobox KN domain |
PROSITE pattern | PS00027 | 0 | 140 | 163 | IPR017970 | Homeobox, conserved site |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 182 aa Download sequence Send to blast |
MYQKGAWEGL RITPVTWGEM ARMRFRFAVE LLHCNCCCFT FLLEVSGNDE MRPNEGDASS 60 DEDFSGGEVE APETQPRGED RDLKDRLLRK FGNHISTLKL EFSKKKKKGK LPKEARQTLL 120 EWWSVHNKWP YPTEADKIAL AKSTGLDQKQ INNWFINQRK RHWKPSENMQ FALMDSIPGQ 180 Y* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Plays a role in meristem function. Contributes to the shoot apical meristem (SAM) maintenance and organ separation by controlling boundary establishment in embryo in a CUC1, CUC2 and STM-dependent manner. Involved in maintaining cells in an undifferentiated, meristematic state. Probably binds to the DNA sequence 5'-TGAC-3'. {ECO:0000269|PubMed:16798887}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Eucgr.H02544.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Seems to be repressed by AS2 and AS1 but induced by STM, CUC1 and CUC2. {ECO:0000269|PubMed:11311158, ECO:0000269|PubMed:16798887}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010023500.1 | 5e-89 | PREDICTED: homeobox protein knotted-1-like 6 | ||||
Refseq | XP_010023501.1 | 5e-89 | PREDICTED: homeobox protein knotted-1-like 6 | ||||
Swissprot | Q84JS6 | 5e-57 | KNAT6_ARATH; Homeobox protein knotted-1-like 6 | ||||
TrEMBL | A0A059B1M5 | 1e-134 | A0A059B1M5_EUCGR; Uncharacterized protein | ||||
STRING | XP_010023500.1 | 2e-88 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM835 | 27 | 85 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G23380.1 | 5e-51 | KNOTTED1-like homeobox gene 6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Eucgr.H02544.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|