PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.F03169.3.p
Common NameEUGRSUZ_F03169
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family NF-YA
Protein Properties Length: 189aa    MW: 21365.1 Da    PI: 10.1086
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.F03169.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA103.22.3e-322985158
         CBFB_NFYA  1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
                      +ep+YVNaKQy++Il+RRq Rakl +e+kl +k rkpylheSRh+hA+rRpRgsgGrF
  Eucgr.F03169.3.p 29 EEPVYVNAKQYHGILRRRQYRAKLGAENKL-IKDRKPYLHESRHHHAVRRPRGSGGRF 85
                      69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.3E-352788IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.2252888IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.9E-273085IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006168.1E-243153IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006168.1E-246285IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MVLMNQISYP QMAGMIPSRL PLPFDTTQEE PVYVNAKQYH GILRRRQYRA KLGAENKLIK  60
DRKPYLHESR HHHAVRRPRG SGGRFLSKDQ KESKFTSLND ESNVKSTARV SSAIDLPNSE  120
VCQLKDHRDT GSTTSCSKTT QTTTSSDAIP VSKFRFFGQP WHVMTTCDPS CDVRYSGDIR  180
HLSLPGER*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A3e-232993266NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.F03169.3.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010062677.11e-135PREDICTED: nuclear transcription factor Y subunit A-3 isoform X1
RefseqXP_018731962.11e-135PREDICTED: nuclear transcription factor Y subunit A-3 isoform X2
TrEMBLA0A059BUY41e-139A0A059BUY4_EUCGR; Uncharacterized protein
STRINGXP_010062677.11e-134(Eucalyptus grandis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.11e-41nuclear factor Y, subunit A3