PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Eucgr.F02193.1.p | ||||||||
Common Name | EUGRSUZ_F02193 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 121aa MW: 13488 Da PI: 10.6209 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 20 | 1.5e-06 | 3 | 42 | 16 | 55 |
HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 16 AArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 AA rsR+RKka++ Le k k Le++ ++L l+ e Eucgr.F02193.1.p 3 AAVRSRERKKAYVRDLEVKGKYLEGKCRRLGRLLQCVMAE 42 99***********************998887666655555 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF57959 | 2.88E-6 | 3 | 49 | No hit | No description |
Gene3D | G3DSA:1.20.5.170 | 1.3E-6 | 3 | 51 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0016021 | Cellular Component | integral component of membrane |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 121 aa Download sequence Send to blast |
MNAAVRSRER KKAYVRDLEV KGKYLEGKCR RLGRLLQCVM AENQALRFSL ENNACGASVA 60 KQESAVLSDS LPLGSLFWFL CITCLFTLPL SLLLASEASR RYKASRTKMK AGFLLPRVWA 120 * |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in endoplasmic reticulum (ER) stress response (PubMed:21223397, PubMed:22050533, PubMed:22199238). Acts downstream of the ER stress sensors IRE1, BZIP39 and BZIP60 to activate BiP chaperone genes (PubMed:22050533, PubMed:22199238). {ECO:0000269|PubMed:21223397, ECO:0000269|PubMed:22050533, ECO:0000269|PubMed:22199238}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Eucgr.F02193.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By dithiothreitol-induced endoplasmic reticulum (ER) stress response (PubMed:22050533, PubMed:21223397). Induced by salt stress (PubMed:22050533). {ECO:0000269|PubMed:21223397, ECO:0000269|PubMed:22050533}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010061241.1 | 1e-54 | PREDICTED: bZIP transcription factor 60 | ||||
Swissprot | Q69XV0 | 2e-26 | BZP50_ORYSJ; bZIP transcription factor 50 | ||||
TrEMBL | A0A059BR21 | 2e-80 | A0A059BR21_EUCGR; Uncharacterized protein | ||||
STRING | XP_010061241.1 | 5e-54 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4634 | 28 | 48 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G42990.1 | 1e-18 | basic region/leucine zipper motif 60 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Eucgr.F02193.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|