PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Eucgr.F02145.2.p | ||||||||
Common Name | EUGRSUZ_F02145 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 225aa MW: 25510.2 Da PI: 8.0744 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 80.8 | 9e-26 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+i+ + rqvtfskR+ g++KKA+ELSvLCda+v++iifs tgkl+++ss Eucgr.F02145.2.p 9 KKIDKLTARQVTFSKRKRGLIKKAQELSVLCDADVSLIIFSATGKLHDFSS 59 6789999******************************************96 PP | |||||||
2 | K-box | 46.6 | 1.5e-16 | 106 | 172 | 33 | 99 |
K-box 33 reqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 +e+R+++GedLe L+ +eL+qLe++Le +l+ + ++K+e ++i++lq+ e +l +enk+L+++++ Eucgr.F02145.2.p 106 HELRQMKGEDLEGLNGEELEQLEKKLEAGLSLVIKTKEEQTWNEINKLQREEAQLIKENKQLKHEMK 172 789************************************************************9875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 6.0E-35 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 28.09 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 6.26E-36 | 2 | 75 | No hit | No description |
SuperFamily | SSF55455 | 1.83E-29 | 3 | 80 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.5E-24 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.0E-22 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.5E-24 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.5E-24 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 11.301 | 87 | 177 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 1.5E-13 | 94 | 171 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 225 aa Download sequence Send to blast |
MAREKTKIKK IDKLTARQVT FSKRKRGLIK KAQELSVLCD ADVSLIIFSA TGKLHDFSSS 60 SMEDTLTRYY GHHSNKVEKP VRPCVALEIE NTNWKMLCNE VYDQAHELRQ MKGEDLEGLN 120 GEELEQLEKK LEAGLSLVIK TKEEQTWNEI NKLQREEAQL IKENKQLKHE MKILDRGKLV 180 TVNSELVNNV SIGSSSIPPL DDDSPYPPSS GWQTIRTGLL KMST* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 3e-17 | 1 | 69 | 1 | 69 | MEF2C |
5f28_B | 3e-17 | 1 | 69 | 1 | 69 | MEF2C |
5f28_C | 3e-17 | 1 | 69 | 1 | 69 | MEF2C |
5f28_D | 3e-17 | 1 | 69 | 1 | 69 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that mediates floral transition in response to vernalization. Promotes inflorescence fate in apical meristems. Acts in a dosage-dependent manner. Probably involved in the transduction of RLK-mediated signaling (e.g. IMK3 pathway). Together with AP1 and SVP, controls the identity of the floral meristem and regulates expression of class B, C and E genes. When associated with SOC1, mediates effect of gibberellins on flowering under short-day conditions, and regulates the expression of LEAFY (LFY), which links floral induction and floral development. Confers inflorescence characteristics to floral primordia and early flowering. {ECO:0000269|PubMed:12451184, ECO:0000269|PubMed:12609028, ECO:0000269|PubMed:12881501, ECO:0000269|PubMed:14716314, ECO:0000269|PubMed:16679456, ECO:0000269|PubMed:18339670, ECO:0000269|PubMed:18466303, ECO:0000269|PubMed:18694458, ECO:0000269|PubMed:19656343}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Eucgr.F02145.2.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by vernalization in a FLC-independent manner. Repressed by the floral homeotic genes AP1, LFY and SEP3 in emerging floral meristems to establish a floral identity and prevent inflorescence fate. Up-regulated at the shoot apex by SOC1. {ECO:0000269|PubMed:12609028, ECO:0000269|PubMed:14716314, ECO:0000269|PubMed:17428825, ECO:0000269|PubMed:18339670, ECO:0000269|PubMed:18694458}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018731858.1 | 1e-165 | PREDICTED: MADS-box protein AGL24 isoform X2 | ||||
Swissprot | O82794 | 6e-63 | AGL24_ARATH; MADS-box protein AGL24 | ||||
TrEMBL | A0A059BQR6 | 1e-164 | A0A059BQR6_EUCGR; Uncharacterized protein | ||||
STRING | XP_010061534.1 | 1e-121 | (Eucalyptus grandis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G24540.1 | 2e-46 | AGAMOUS-like 24 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Eucgr.F02145.2.p |