PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Eucgr.E02410.1.p | ||||||||
Common Name | EUGRSUZ_E02410 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 117aa MW: 12430.3 Da PI: 7.0817 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 116.8 | 1.3e-36 | 38 | 117 | 1 | 80 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvi 80 +CaaCk+lrr+C+++Cvlapyfp ++p+kfa++h++FGasn++k+l +lpe++r+da++s++yeA r+rdPvyG++g i Eucgr.E02410.1.p 38 PCAACKTLRRRCSESCVLAPYFPPSEPAKFAIAHRVFGASNIVKFLLTLPESQRDDAVTSMIYEASTRIRDPVYGCAGAI 117 7****************************************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 24.292 | 37 | 117 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 4.9E-36 | 38 | 117 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 117 aa Download sequence Send to blast |
MESSDTGAFE SSPPSSLVPP SWSSPTPALP LPVVVASPCA ACKTLRRRCS ESCVLAPYFP 60 PSEPAKFAIA HRVFGASNIV KFLLTLPESQ RDDAVTSMIY EASTRIRDPV YGCAGAI |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 3e-35 | 36 | 117 | 9 | 90 | LOB family transfactor Ramosa2.1 |
5ly0_B | 3e-35 | 36 | 117 | 9 | 90 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Eucgr.E02410.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010056894.1 | 8e-80 | PREDICTED: LOB domain-containing protein 1 | ||||
Swissprot | Q9LQR0 | 2e-47 | LBD1_ARATH; LOB domain-containing protein 1 | ||||
TrEMBL | A0A059C5R1 | 1e-77 | A0A059C5R1_EUCGR; Uncharacterized protein (Fragment) | ||||
STRING | XP_010056894.1 | 3e-79 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM131 | 28 | 340 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G07900.1 | 1e-43 | LOB domain-containing protein 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Eucgr.E02410.1.p |