PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Eucgr.E02056.1.p | ||||||||
Common Name | EUGRSUZ_E02056 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 71aa MW: 7648.8 Da PI: 8.2286 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 54.1 | 4.6e-17 | 15 | 62 | 1 | 48 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllka 48 +C Ck+ +r+Ca+dCv+ap pa++p+kfanvh++FGasnv k+ + Eucgr.E02056.1.p 15 PCTLCKLPQRRCAQDCVFAPNCPADEPHKFANVHEVFGASNVNKMFQV 62 7********************************************985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 14.613 | 14 | 70 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 5.5E-16 | 15 | 61 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 71 aa Download sequence Send to blast |
MKESGGGWKQ GMPSPCTLCK LPQRRCAQDC VFAPNCPADE PHKFANVHEV FGASNVNKMF 60 QVTHLISSSV * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 2e-14 | 11 | 60 | 7 | 56 | LOB family transfactor Ramosa2.1 |
5ly0_B | 2e-14 | 11 | 60 | 7 | 56 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Eucgr.E02056.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010058727.1 | 8e-40 | PREDICTED: B3 domain-containing protein At2g33720 | ||||
Swissprot | Q9SHE9 | 6e-24 | LBD4_ARATH; LOB domain-containing protein 4 | ||||
TrEMBL | A0A059C5B2 | 1e-45 | A0A059C5B2_EUCGR; Uncharacterized protein | ||||
STRING | XP_010058727.1 | 3e-39 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM12282 | 14 | 32 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G31320.1 | 3e-26 | LOB domain-containing protein 4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Eucgr.E02056.1.p |