PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.D01764.1.p
Common NameEUGRSUZ_D01764, LOC104441675
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family ARF
Protein Properties Length: 657aa    MW: 73528.2 Da    PI: 6.5639
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.D01764.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B376.53e-24116216198
                       EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
                B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                       f+kvlt sd++++g +++ +k+a+e+     +++++ +++l  +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD++vF   + +
  Eucgr.D01764.1.p 116 FCKVLTASDTSTHGGFSVLRKHATEClppldMNQSTPTQELAARDLHGYEWKFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDSFVFL--RGE 206
                       99****************************9445555669************************************************..449 PP

                       EE..EEEEE- CS
                B3  89 efelvvkvfr 98 
                       ++el+v+v+r
  Eucgr.D01764.1.p 207 SGELRVGVRR 216
                       999*****98 PP

2Auxin_resp107.81.2e-35242321183
        Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                       a+ha++t++ F v+Y+Pr+  s+F+++++k+++a+++k+svGmRfkm+fe+eds+err+sGt+vgv+d+++ +W++SkWrsLk
  Eucgr.D01764.1.p 242 ASHAVQTQTLFVVYYKPRT--SQFIISLNKYLEAVNNKFSVGMRFKMRFEGEDSPERRFSGTIVGVEDISS-QWTDSKWRSLK 321
                       789***************6..9**********************************************777.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019365.36E-40104245IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.107.7E-41108231IPR015300DNA-binding pseudobarrel domain
CDDcd100171.03E-19114216No hitNo description
SMARTSM010198.3E-23116218IPR003340B3 DNA binding domain
PfamPF023623.7E-22116216IPR003340B3 DNA binding domain
PROSITE profilePS5086312.21116218IPR003340B3 DNA binding domain
PfamPF065071.5E-33242321IPR010525Auxin response factor
PfamPF023095.1E-8542587IPR033389AUX/IAA domain
SuperFamilySSF542779.81E-14549627No hitNo description
PROSITE profilePS5174525.801551643IPR000270PB1 domain
PfamPF023091.1E-5597640IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 657 aa     Download sequence    Send to blast
MANRGGGEDD LYTELWKACA GPLVDVPRAG ERVFYFPQGH MEQLEASTNQ ELNERIPLFN  60
LPPKILCRVM YIQLLAEQET DEVYAQITLL PEAPQSEPMS PDPYLPEPPR PRVHSFCKVL  120
TASDTSTHGG FSVLRKHATE CLPPLDMNQS TPTQELAARD LHGYEWKFKH IFRGQPRRHL  180
LTTGWSTFVT SKRLVAGDSF VFLRGESGEL RVGVRRMARQ QSTMPASVIS SQSMHLGVLA  240
TASHAVQTQT LFVVYYKPRT SQFIISLNKY LEAVNNKFSV GMRFKMRFEG EDSPERRFSG  300
TIVGVEDISS QWTDSKWRSL KVQWDEHASV PRPDRVSPWE IESSVPSIPP SMTESAVAKK  360
RPRPPAELPA LDTAGATLHD VGLMQSCDST QPTVFIEGKR SDNHGIWHHK QTSVNTGSNS  420
ISWPQTEGDR QFSPSVCGWP LLSSSTMHSP KPRNEPKVEL AEKPERPTSC RLFGIDLINH  480
SSNSQQVDRL TVQPLDGSAG INETHTPGNA PAADSQQKSV VLKTSKEIIP KQSVVSPKEI  540
RSKQSCSTTA RSRIKVQMQG VAVGRAVDLT MFEEYDQLID ELEEMFEIKG ELRPRNKWEI  600
VFTDDEGDMM LVGDDPWPEF CNMARRIFIW SSQDVKKMSP GSRLPVSSVE EEGSLA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-174934217353Auxin response factor 1
4ldw_A1e-174934217353Auxin response factor 1
4ldw_B1e-174934217353Auxin response factor 1
4ldx_A1e-174934217353Auxin response factor 1
4ldx_B1e-174934217353Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1359363KRPRP
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.D01764.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010053162.10.0PREDICTED: auxin response factor 9
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLA0A059CGC60.0A0A059CGC6_EUCGR; Auxin response factor
STRINGXP_010053162.10.0(Eucalyptus grandis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27642762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.20.0auxin response factor 9