PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Eucgr.C01264.1.p | ||||||||
Common Name | EUGRSUZ_C01264 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 136aa MW: 15532.7 Da PI: 7.9122 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 80.2 | 4.6e-25 | 6 | 123 | 6 | 128 |
NAM 6 rFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 +++Ptde l+++yL++kv gk+l+l i+e+d+y+ ePw++ +++ + ++ y F++ k g+r++r++ sg+Wk + ++ ++++ +g Eucgr.C01264.1.p 6 KYRPTDECLITDYLQPKVMGKPLPL-GQIDECDLYSQEPWKIFNTTLELKQTFYVFTELTK---MGSRNSRTVGSGTWKGQHRT-KIFNDGGD 93 799**********************.78**************7433333445577777655...589************99885.56666999 PP NAM 99 lvglkktLvfykgrapkgektdWvmheyrl 128 g kk++ f +g p++++ +W+m+e+++ Eucgr.C01264.1.p 94 FLGYKKSFKFQEGGGPSATSGRWIMKEFSM 123 ****************************86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 27.987 | 1 | 135 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.3E-15 | 6 | 122 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 3.14E-28 | 6 | 133 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 136 aa Download sequence Send to blast |
MNSLAKYRPT DECLITDYLQ PKVMGKPLPL GQIDECDLYS QEPWKIFNTT LELKQTFYVF 60 TELTKMGSRN SRTVGSGTWK GQHRTKIFND GGDFLGYKKS FKFQEGGGPS ATSGRWIMKE 120 FSMCDEREEW FLCVG* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 4e-18 | 6 | 133 | 22 | 160 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 4e-18 | 6 | 133 | 22 | 160 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 4e-18 | 6 | 133 | 22 | 160 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 4e-18 | 6 | 133 | 22 | 160 | NO APICAL MERISTEM PROTEIN |
3swm_A | 5e-18 | 6 | 133 | 25 | 163 | NAC domain-containing protein 19 |
3swm_B | 5e-18 | 6 | 133 | 25 | 163 | NAC domain-containing protein 19 |
3swm_C | 5e-18 | 6 | 133 | 25 | 163 | NAC domain-containing protein 19 |
3swm_D | 5e-18 | 6 | 133 | 25 | 163 | NAC domain-containing protein 19 |
3swp_A | 5e-18 | 6 | 133 | 25 | 163 | NAC domain-containing protein 19 |
3swp_B | 5e-18 | 6 | 133 | 25 | 163 | NAC domain-containing protein 19 |
3swp_C | 5e-18 | 6 | 133 | 25 | 163 | NAC domain-containing protein 19 |
3swp_D | 5e-18 | 6 | 133 | 25 | 163 | NAC domain-containing protein 19 |
4dul_A | 4e-18 | 6 | 133 | 22 | 160 | NAC domain-containing protein 19 |
4dul_B | 4e-18 | 6 | 133 | 22 | 160 | NAC domain-containing protein 19 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Eucgr.C01264.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010050567.1 | 4e-91 | PREDICTED: NAC domain-containing protein 67 | ||||
TrEMBL | A0A059CNL1 | 2e-96 | A0A059CNL1_EUCGR; Uncharacterized protein | ||||
STRING | XP_010050567.1 | 1e-90 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM13343 | 7 | 27 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G10480.2 | 2e-20 | NAC domain containing protein 50 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Eucgr.C01264.1.p |