PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Eucgr.B01624.1.p | ||||||||
Common Name | EUGRSUZ_B01624, LOC104434876 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 128aa MW: 14697.9 Da PI: 9.7558 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 71 | 3.2e-22 | 4 | 119 | 4 | 128 |
NAM 4 GfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 ++F+Ptde l ++yL++k+ g +l+ i+e+d+++ ePw++ + + e+ y F++ +k t++r r++ s +Wk++ +++ Eucgr.B01624.1.p 4 LVKFRPTDEHLFTHYLQQKAMGAPLPP-GLIEECDLNSQEPWRIF-DT-TLEQTFYVFTTLRK---TKSRVLRTAGSETWKEQHA-TKISL-- 87 589*********************999.89**************6.32.23456677777766...46799**999*****9977.56766.. PP NAM 97 gelvglkktLvfykgrapkgektdWvmheyrl 128 gelvg kk++ f gr +++++ +W+m e+++ Eucgr.B01624.1.p 88 GELVGYKKSFKFQGGRGSSATSGRWIMYEFSM 119 79****************************86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 25.736 | 1 | 127 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.1E-15 | 3 | 118 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 2.09E-23 | 5 | 122 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 128 aa Download sequence Send to blast |
MNPLVKFRPT DEHLFTHYLQ QKAMGAPLPP GLIEECDLNS QEPWRIFDTT LEQTFYVFTT 60 LRKTKSRVLR TAGSETWKEQ HATKISLGEL VGYKKSFKFQ GGRGSSATSG RWIMYEFSMC 120 DERVVKK* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 4e-15 | 1 | 119 | 15 | 140 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Eucgr.B01624.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010046032.1 | 4e-92 | PREDICTED: NAC domain-containing protein 2 | ||||
TrEMBL | A0A059D3N1 | 8e-91 | A0A059D3N1_EUCGR; Uncharacterized protein | ||||
STRING | XP_010046032.1 | 1e-91 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM13343 | 7 | 27 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G77450.1 | 2e-18 | NAC domain containing protein 32 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Eucgr.B01624.1.p |
Entrez Gene | 104434876 |