PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Eucgr.A02846.3.p | ||||||||
Common Name | EUGRSUZ_A02846 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 215aa MW: 24653.3 Da PI: 9.1473 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 93.4 | 1.1e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien + rq tfskRrng++KKA+ELSvLCdaevaviifs++g+lye+ss Eucgr.A02846.3.p 9 KRIENATSRQATFSKRRNGLMKKAFELSVLCDAEVAVIIFSQRGRLYEFSS 59 79***********************************************96 PP | |||||||
2 | K-box | 69.5 | 1e-23 | 79 | 172 | 7 | 99 |
K-box 7 ks.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 k+ e+ + +l++e+a + ++ie L+ ++R++lG++Les+s+ eLq++ qLe+sl++iR kK++l++eqie+l+ ke l een +L +k+ Eucgr.A02846.3.p 79 KKaSMEQYMLHLKHEAADMSRKIELLEASKRKFLGQGLESCSVDELQEISVQLERSLSTIRVKKDQLFKEQIEQLKAKEVFLIEENSRLCEKY 171 334667788899*****************************************************************************9987 PP K-box 99 e 99 Eucgr.A02846.3.p 172 G 172 5 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 6.3E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 32.17 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 4.57E-42 | 2 | 76 | No hit | No description |
PRINTS | PR00404 | 2.7E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 2.22E-33 | 3 | 79 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 4.2E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.7E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.7E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 13.695 | 87 | 177 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 6.4E-24 | 89 | 171 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009838 | Biological Process | abscission | ||||
GO:0009909 | Biological Process | regulation of flower development | ||||
GO:0010150 | Biological Process | leaf senescence | ||||
GO:0080187 | Biological Process | floral organ senescence | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 215 aa Download sequence Send to blast |
MARGKIQMKR IENATSRQAT FSKRRNGLMK KAFELSVLCD AEVAVIIFSQ RGRLYEFSSS 60 NMQKTIERYH QYAKEDTGKK ASMEQYMLHL KHEAADMSRK IELLEASKRK FLGQGLESCS 120 VDELQEISVQ LERSLSTIRV KKDQLFKEQI EQLKAKEVFL IEENSRLCEK YGEKGMPWQS 180 TSSVQPKEAR IHSLSSGSTD VETELFIGLP EMRC* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 3e-21 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 3e-21 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_R | 3e-21 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_S | 3e-21 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_A | 3e-21 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_B | 3e-21 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_C | 3e-21 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_D | 3e-21 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_E | 3e-21 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_F | 3e-21 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00576 | DAP | Transfer from AT5G62165 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Eucgr.A02846.3.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018716225.1 | 1e-157 | PREDICTED: MADS-box protein SOC1 | ||||
Refseq | XP_018716231.1 | 1e-157 | PREDICTED: MADS-box protein SOC1 | ||||
Refseq | XP_018716232.1 | 1e-157 | PREDICTED: MADS-box protein SOC1 | ||||
Refseq | XP_018716234.1 | 1e-157 | PREDICTED: MADS-box protein SOC1 | ||||
Swissprot | Q9FIS1 | 2e-80 | AGL42_ARATH; MADS-box protein AGL42 | ||||
TrEMBL | A0A059DK35 | 1e-155 | A0A059DK35_EUCGR; Uncharacterized protein | ||||
STRING | XP_010061717.1 | 1e-119 | (Eucalyptus grandis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G62165.3 | 1e-82 | AGAMOUS-like 42 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Eucgr.A02846.3.p |