PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Eucgr.A02637.1.p | ||||||||
Common Name | EUGRSUZ_A02637, LOC104447510 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 178aa MW: 20616.6 Da PI: 9.014 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 133.6 | 1.4e-41 | 4 | 137 | 1 | 127 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkk....leleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWka 85 lppGfrF Pt+eelv++yL++k+e+++ ++++vi+ +diy+++PwdLp+ ++a+ ++w+fF++ + ++ +g r++r t++gyWka Eucgr.A02637.1.p 4 LPPGFRFFPTEEELVSFYLRNKLEATReallGQIQRVISVLDIYEFDPWDLPQfaadLCHADPEQWFFFIPMQDSEYHGGRPRRLTTTGYWKA 96 79**********************99978776667789999***********656664455778***************************** PP NAM 86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyr 127 tg+ v+s +++ +glk+t+vfy+gr+p+g kt+W m+ey+ Eucgr.A02637.1.p 97 TGSPGFVYS-SNRIIGLKRTMVFYTGRTPNGMKTEWKMNEYK 137 *********.8999***************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.44E-46 | 2 | 165 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 46.891 | 4 | 165 | IPR003441 | NAC domain |
Pfam | PF02365 | 3.8E-22 | 5 | 137 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 178 aa Download sequence Send to blast |
MEGLPPGFRF FPTEEELVSF YLRNKLEATR EALLGQIQRV ISVLDIYEFD PWDLPQFAAD 60 LCHADPEQWF FFIPMQDSEY HGGRPRRLTT TGYWKATGSP GFVYSSNRII GLKRTMVFYT 120 GRTPNGMKTE WKMNEYKAIE GAASSPQEIP VAPRHEFSVC RVYKKTKTLR SFDRRPM* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 8e-34 | 4 | 168 | 17 | 168 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 8e-34 | 4 | 168 | 17 | 168 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 8e-34 | 4 | 168 | 17 | 168 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 8e-34 | 4 | 168 | 17 | 168 | NO APICAL MERISTEM PROTEIN |
3swm_A | 8e-34 | 4 | 168 | 20 | 171 | NAC domain-containing protein 19 |
3swm_B | 8e-34 | 4 | 168 | 20 | 171 | NAC domain-containing protein 19 |
3swm_C | 8e-34 | 4 | 168 | 20 | 171 | NAC domain-containing protein 19 |
3swm_D | 8e-34 | 4 | 168 | 20 | 171 | NAC domain-containing protein 19 |
3swp_A | 8e-34 | 4 | 168 | 20 | 171 | NAC domain-containing protein 19 |
3swp_B | 8e-34 | 4 | 168 | 20 | 171 | NAC domain-containing protein 19 |
3swp_C | 8e-34 | 4 | 168 | 20 | 171 | NAC domain-containing protein 19 |
3swp_D | 8e-34 | 4 | 168 | 20 | 171 | NAC domain-containing protein 19 |
4dul_A | 8e-34 | 4 | 168 | 17 | 168 | NAC domain-containing protein 19 |
4dul_B | 8e-34 | 4 | 168 | 17 | 168 | NAC domain-containing protein 19 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Eucgr.A02637.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010059543.1 | 1e-131 | PREDICTED: NAC domain-containing protein 90 isoform X2 | ||||
Swissprot | Q9FMR3 | 3e-62 | NAC90_ARATH; NAC domain-containing protein 90 | ||||
TrEMBL | A0A059DIE4 | 1e-130 | A0A059DIE4_EUCGR; Uncharacterized protein | ||||
STRING | XP_010059543.1 | 1e-131 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM10159 | 10 | 34 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G22380.1 | 1e-64 | NAC domain containing protein 90 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Eucgr.A02637.1.p |
Entrez Gene | 104447510 |
Publications ? help Back to Top | |||
---|---|---|---|
|