PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcS785456.10 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 128aa MW: 14276 Da PI: 9.8862 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 125.1 | 2.2e-39 | 17 | 76 | 3 | 62 |
zf-Dof 3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 ++ l cprCdstntkfCy+nny+lsqPr+fCk+C+ryWtkGG+lrn+PvGgg+rk+ +++ EcS785456.10 17 QERLICPRCDSTNTKFCYFNNYNLSQPRHFCKNCKRYWTKGGSLRNIPVGGGTRKKSSTK 76 67889**************************************************98875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 4.0E-27 | 14 | 71 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 4.0E-33 | 19 | 74 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 28.761 | 20 | 74 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 22 | 58 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 128 aa Download sequence Send to blast |
MQETTAFQST KLLFPEQERL ICPRCDSTNT KFCYFNNYNL SQPRHFCKNC KRYWTKGGSL 60 RNIPVGGGTR KKSSTKRASN PKRQNPDPDP DPRPSKHGLQ LQESATADSL QSNATEGALL 120 EGPNSSGL |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010062587.1 | 7e-91 | PREDICTED: dof zinc finger protein DOF3.1 | ||||
Swissprot | O82155 | 3e-37 | DOF17_ARATH; Dof zinc finger protein DOF1.7 | ||||
TrEMBL | A0A059BUT8 | 2e-90 | A0A059BUT8_EUCGR; Uncharacterized protein | ||||
STRING | XP_010062587.1 | 3e-90 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM1269 | 28 | 96 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G51700.1 | 3e-39 | DOF zinc finger protein 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|