PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcS774074.10 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 168aa MW: 18855.1 Da PI: 9.9447 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 56.5 | 6.6e-18 | 13 | 58 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+W+++Ed l +v+q+G+++W++I+ ++ gR++k+c++rw + EcS774074.10 13 KGSWSPQEDATLMTLVEQHGPRNWSLISTGIP-GRSGKSCRLRWCNQ 58 799*****************************.***********985 PP | |||||||
2 | Myb_DNA-binding | 54.7 | 2.2e-17 | 67 | 109 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++T+ Ed +v+a+k +G++ W+tIar ++ gRt++ +k++w++ EcS774074.10 67 PFTPLEDATIVEAHKVHGNK-WATIARLLP-GRTDNAIKNHWNST 109 89******************.*********.***********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 24.8 | 8 | 63 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.05E-30 | 10 | 106 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.0E-14 | 12 | 61 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.0E-17 | 13 | 58 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.2E-24 | 14 | 66 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.98E-13 | 15 | 57 | No hit | No description |
SMART | SM00717 | 4.6E-14 | 64 | 112 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 20.556 | 64 | 114 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.5E-23 | 67 | 113 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.83E-11 | 67 | 110 | No hit | No description |
Pfam | PF00249 | 2.3E-14 | 67 | 109 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 168 aa Download sequence Send to blast |
MRVTSVDGVD RVKGSWSPQE DATLMTLVEQ HGPRNWSLIS TGIPGRSGKS CRLRWCNQLS 60 PTVQHRPFTP LEDATIVEAH KVHGNKWATI ARLLPGRTDN AIKNHWNSTL RRKRPGEQSS 120 MSSESNSEKH PGRDNTAAES ETDLEIKRQC LRVLPDENSR DGEVRPKG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 5e-38 | 10 | 113 | 4 | 107 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in auxin response. Functions in auxin signal transduction and modulates lateral root growth. Interacts with ARF response factors to promote auxin-responsive gene expression (PubMed:17675404). In response to auxin, binds sequence-specific motifs in the promoter of the auxin-responsive gene IAA19, and activates IAA19 transcription. The IAA19 transcription activation by MYB77 is enhanced by direct interaction between MYB77 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:17675404, ECO:0000269|PubMed:24894996}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by auxin (PubMed:17675404). Down-regulated by potassium deprivation (PubMed:15173595). {ECO:0000269|PubMed:15173595, ECO:0000269|PubMed:17675404}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010031187.1 | 1e-119 | PREDICTED: myb-related protein A | ||||
Swissprot | Q9SN12 | 7e-52 | MYB77_ARATH; Transcription factor MYB77 | ||||
TrEMBL | A0A059A9S4 | 1e-100 | A0A059A9S4_EUCGR; Uncharacterized protein (Fragment) | ||||
STRING | XP_010031187.1 | 1e-119 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM677 | 28 | 135 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G23290.1 | 6e-55 | myb domain protein 70 |
Publications ? help Back to Top | |||
---|---|---|---|
|