PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcS737051.10 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 92aa MW: 10700.5 Da PI: 10.302 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 52.1 | 1.5e-16 | 15 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+ Ed++l d++k +G g W+ I++ g++R++k+c+ rw++yl EcS737051.10 15 RGAWTAREDKILTDYIKVHGEGKWRNIPKIAGLKRCGKSCRMRWLNYL 62 89*********************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 2.5E-23 | 7 | 65 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 21.845 | 10 | 66 | IPR017930 | Myb domain |
SMART | SM00717 | 5.9E-13 | 14 | 64 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.1E-14 | 15 | 62 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.84E-23 | 16 | 91 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 8.87E-10 | 17 | 62 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 3.2E-8 | 66 | 91 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 7.21 | 67 | 92 | IPR017930 | Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 92 aa Download sequence Send to blast |
MGRSPCCSKE EGLNRGAWTA REDKILTDYI KVHGEGKWRN IPKIAGLKRC GKSCRMRWLN 60 YLRPDIKRGN ITSDEEDLIL RLHKLLGNRY SI |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 2e-15 | 13 | 91 | 25 | 102 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010047391.1 | 3e-59 | PREDICTED: transcription factor WER | ||||
Swissprot | P10290 | 4e-43 | MYBC_MAIZE; Anthocyanin regulatory C1 protein | ||||
TrEMBL | A0A059CMZ8 | 5e-58 | A0A059CMZ8_EUCGR; Uncharacterized protein | ||||
STRING | XP_010047391.1 | 1e-58 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G05100.1 | 3e-43 | myb domain protein 74 |