PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcS720831.10 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 104aa MW: 11832 Da PI: 5.6262 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 86.4 | 2.7e-27 | 63 | 104 | 2 | 43 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkG 43 ++k+++cprC+s++tkfCyynny+++qPr+fC+aC+ryWt+G EcS720831.10 63 PDKIIPCPRCNSMDTKFCYYNNYNVNQPRHFCRACQRYWTAG 104 7899************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 5.0E-22 | 51 | 104 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 1.2E-22 | 65 | 104 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 23.123 | 67 | 104 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 104 aa Download sequence Send to blast |
MQEEDEPPPN SQELDPSRTS PDAVNPMTPS IQEESTTSHI TETGAQEEHG TPKNSQGKTL 60 KKPDKIIPCP RCNSMDTKFC YYNNYNVNQP RHFCRACQRY WTAG |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Regulates a photoperiodic flowering response. Transcriptional repressor of 'CONSTANS' expression. The stability of CDF2 is controlled by 'GIGANTEA' and redundantly by ADO3, ADO2 and/or ADO1. {ECO:0000250, ECO:0000269|PubMed:19619493}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian-regulation. Highly expressed at the beginning of the light period, then decreases, reaching a minimum between 16 and 29 hours after dawn before rising again at the end of the day. Regulated at the protein level by ADO3 and GI pos-transcriptionally. {ECO:0000269|PubMed:19619493}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010037174.1 | 6e-67 | PREDICTED: cyclic dof factor 3 isoform X2 | ||||
Swissprot | Q93ZL5 | 4e-29 | CDF2_ARATH; Cyclic dof factor 2 | ||||
TrEMBL | A0A059A674 | 2e-65 | A0A059A674_EUCGR; Uncharacterized protein | ||||
STRING | XP_010037173.1 | 3e-66 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM1269 | 28 | 96 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G39660.2 | 2e-31 | cycling DOF factor 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|