PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcS673217.10 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | G2-like | ||||||||
Protein Properties | Length: 37aa MW: 4299.16 Da PI: 11.5503 | ||||||||
Description | G2-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 46.6 | 7.3e-15 | 7 | 36 | 25 | 54 |
G2-like 25 ekAtPktilelmkvkgLtlehvkSHLQkYR 54 +AtPk +l+lm+v gLt++hvkSHLQ R EcS673217.10 7 SEATPKMVLQLMDVRGLTISHVKSHLQVSR 36 57*************************866 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.9E-12 | 7 | 36 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 1.3E-10 | 8 | 36 | IPR006447 | Myb domain, plants |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 37 aa Download sequence Send to blast |
ILFRFISEAT PKMVLQLMDV RGLTISHVKS HLQVSRF |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G14600.1 | 3e-11 | G2-like family protein |