PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EcS668258.10

Organism

Eucalyptus camaldulensis

Taxonomic ID

34316

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus

Family

Dof

Protein Properties

Length: 37aa MW: 4432.03 Da PI: 8.7711

Description

Dof family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EcS668258.10	genome	ECGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	67.9	1.6e-21	4	37	3	36
zf-Dof 3 ekalkcprCdstntkfCyynnyslsqPryfCkaC 36 ++alkcprCds ntkfCyynny+lsqPr+fCk+C EcS668258.10 4 HQALKCPRCDSLNTKFCYYNNYNLSQPRHFCKSC 37 7899****************************** PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD007478	3.0E-12	4	37	IPR003851	Zinc finger, Dof-type
Pfam	PF02701	2.7E-18	5	37	IPR003851	Zinc finger, Dof-type
PROSITE profile	PS50884	19.237	7	37	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 37 aa Download sequence Send to blast
HPNHQALKCP RCDSLNTKFC YYNNYNLSQP RHFCKSC

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements (By similarity). {ECO:0000250}.
UniProt	Transcription factor that may transactivate seed storage protein genes in developing seeds. {ECO:0000250\|UniProtKB:Q6K537}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by gibberellin. {ECO:0000269\|PubMed:11470159}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_017973814.1	3e-22	PREDICTED: dof zinc finger protein DOF5.4 isoform X1
Refseq	XP_021285636.1	5e-22	LOW QUALITY PROTEIN: dof zinc finger protein DOF5.4
Swissprot	Q6Z345	1e-16	DOF4_ORYSJ; Dof zinc finger protein 4
Swissprot	Q8LDR0	1e-16	DOF54_ARATH; Dof zinc finger protein DOF5.4
TrEMBL	A0A061FXE2	1e-20	A0A061FXE2_THECC; OBF binding protein 4, putative
STRING	EOY22160	2e-21	(Theobroma cacao)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G60850.1	5e-19	OBF binding protein 4

Publications ? help Back to Top
Washio K Identification of Dof proteins with implication in the gibberellin-regulated expression of a peptidase gene following the germination of rice grains. Biochim. Biophys. Acta, 2001. 1520(1): p. 54-62 [PMID:11470159] Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Xu P,Chen H,Ying L,Cai W AtDOF5.4/OBP4, a DOF Transcription Factor Gene that Negatively Regulates Cell Cycle Progression and Cell Expansion in Arabidopsis thaliana. Sci Rep, 2016. 6: p. 27705 [PMID:27297966] Ramirez-Parra E, et al. The transcription factor OBP4 controls root growth and promotes callus formation. New Phytol., 2017. 213(4): p. 1787-1801 [PMID:27859363] Rymen B, et al. ABA Suppresses Root Hair Growth via the OBP4 Transcriptional Regulator. Plant Physiol., 2017. 173(3): p. 1750-1762 [PMID:28167701]