PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcS532174.10 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 150aa MW: 15579.2 Da PI: 7.0224 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 117.7 | 5.5e-37 | 2 | 66 | 33 | 97 |
NF-YB 33 etvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 + +qecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+yveplkvyl+k+re+egek EcS532174.10 2 NFMQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEEYVEPLKVYLQKFREIEGEK 66 679************************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.1E-33 | 2 | 76 | IPR009072 | Histone-fold |
Pfam | PF00808 | 7.6E-14 | 2 | 40 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
SuperFamily | SSF47113 | 2.85E-26 | 3 | 76 | IPR009072 | Histone-fold |
PRINTS | PR00615 | 7.9E-22 | 4 | 22 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 7 | 23 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 7.9E-22 | 23 | 41 | No hit | No description |
PRINTS | PR00615 | 7.9E-22 | 42 | 60 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 150 aa Download sequence Send to blast |
RNFMQECVSE FISFITGEAS DKCQREKRKT INGDDLLWAM TTLGFEEYVE PLKVYLQKFR 60 EIEGEKTAAL GKPGERSDGG DGSSSIGGGG GGGGVVNSGG GSAGGYGVGG GGGMYGGMMM 120 MGHHVHHAHH QSHHHMYGSG SGGSSGGRPR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 8e-30 | 4 | 61 | 36 | 93 | NF-YB |
4awl_B | 8e-30 | 4 | 61 | 37 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 8e-30 | 4 | 61 | 37 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002323121.2 | 5e-53 | nuclear transcription factor Y subunit B-3 | ||||
TrEMBL | B9IH15 | 1e-51 | B9IH15_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0016s00780.1 | 2e-52 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM255 | 28 | 229 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 3e-43 | nuclear factor Y, subunit B3 |