PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcS524200.10 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | GRAS | ||||||||
Protein Properties | Length: 88aa MW: 10167.6 Da PI: 6.5289 | ||||||||
Description | GRAS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 68.4 | 1.4e-21 | 2 | 85 | 289 | 373 |
GRAS 289 llgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373 ++ ++i+n++a+eg +r+er e +++W +r+++a F++vp++e+a++++k++l +++ g+ +++e++ lvl+Wk++++ ++ aW EcS524200.10 2 YIYWKIQNIIAQEGLQRIERLEPKSRWVQRMRNADFRAVPFGEDAVSEVKAMLDEHA-AGWGLKKEEDDLVLTWKGHNVAFAAAW 85 57899****************************************************.8999*********************** PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50985 | 12.482 | 1 | 67 | IPR005202 | Transcription factor GRAS |
Pfam | PF03514 | 4.8E-19 | 2 | 85 | IPR005202 | Transcription factor GRAS |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 88 aa Download sequence Send to blast |
SYIYWKIQNI IAQEGLQRIE RLEPKSRWVQ RMRNADFRAV PFGEDAVSEV KAMLDEHAAG 60 WGLKKEEDDL VLTWKGHNVA FAAAWLPA |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in plant development. {ECO:0000250}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010070642.1 | 8e-58 | PREDICTED: scarecrow-like protein 32 | ||||
Swissprot | Q9SN22 | 4e-34 | SCL32_ARATH; Scarecrow-like protein 32 | ||||
TrEMBL | A0A059B0Y0 | 9e-56 | A0A059B0Y0_EUCGR; Uncharacterized protein | ||||
STRING | XP_010070642.1 | 3e-57 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM27411 | 3 | 3 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G49950.1 | 1e-36 | GRAS family protein |