PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC058338.10 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 167aa MW: 17854.8 Da PI: 4.5732 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 40.1 | 8.2e-13 | 82 | 136 | 2 | 56 |
XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 +++k+ rr +NR AA rsR+RKka+++ Le k+k Le+e ++L l+ e+ EcC058338.10 82 PASKKLRRQLRNRDAAVRSRERKKAYVKDLEVKSKYLEGECRRLGRLLQCVMAES 136 689*************************************998876666555555 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 8.6E-7 | 81 | 145 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.013 | 83 | 140 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 4.3E-11 | 83 | 140 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 4.3E-11 | 83 | 144 | No hit | No description |
SuperFamily | SSF57959 | 5.5E-11 | 85 | 141 | No hit | No description |
CDD | cd14704 | 3.73E-14 | 86 | 137 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 88 | 103 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 167 aa Download sequence Send to blast |
IENILMKDDE DGGVVGGGIR ADSSQEFCDR FLADVLVESP GDGSAEIADG SGDKEEPGSS 60 DDGGIEAAKV DGANGGGEAY DPASKKLRRQ LRNRDAAVRS RERKKAYVKD LEVKSKYLEG 120 ECRRLGRLLQ CVMAESQALR FSLQNSECGA SVAKLESAVL SGMRLEP |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in endoplasmic reticulum (ER) stress response (PubMed:21223397, PubMed:22050533, PubMed:22199238). Acts downstream of the ER stress sensors IRE1, BZIP39 and BZIP60 to activate BiP chaperone genes (PubMed:22050533, PubMed:22199238). {ECO:0000269|PubMed:21223397, ECO:0000269|PubMed:22050533, ECO:0000269|PubMed:22199238}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By dithiothreitol-induced endoplasmic reticulum (ER) stress response (PubMed:22050533, PubMed:21223397). Induced by salt stress (PubMed:22050533). {ECO:0000269|PubMed:21223397, ECO:0000269|PubMed:22050533}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010041444.1 | 1e-93 | PREDICTED: bZIP transcription factor 60 | ||||
Swissprot | Q69XV0 | 7e-26 | BZP50_ORYSJ; bZIP transcription factor 50 | ||||
TrEMBL | A0A058ZRB7 | 3e-92 | A0A058ZRB7_EUCGR; Uncharacterized protein | ||||
STRING | XP_010041444.1 | 6e-93 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4634 | 28 | 48 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G42990.1 | 2e-12 | basic region/leucine zipper motif 60 |
Publications ? help Back to Top | |||
---|---|---|---|
|