PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC055224.140 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 208aa MW: 23523.9 Da PI: 6.0422 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 62.8 | 3.9e-20 | 17 | 63 | 3 | 49 |
--SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 i k qvtfskRr g++KKA+EL++LC++++ +i+fs+ k++ + EcC055224.140 17 IPKKNHLQVTFSKRRSGLFKKASELCTLCGVDIGIIVFSPASKVFSF 63 55677789**********************************99987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 22.567 | 7 | 67 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 8.5E-29 | 7 | 66 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 2.22E-24 | 8 | 78 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.57E-32 | 8 | 76 | No hit | No description |
PRINTS | PR00404 | 1.8E-16 | 9 | 29 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 4.0E-23 | 16 | 63 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-16 | 29 | 44 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-16 | 44 | 65 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006869 | Biological Process | lipid transport | ||||
GO:0008272 | Biological Process | sulfate transport | ||||
GO:0016567 | Biological Process | protein ubiquitination | ||||
GO:0051603 | Biological Process | proteolysis involved in cellular protein catabolic process | ||||
GO:0055085 | Biological Process | transmembrane transport | ||||
GO:0055114 | Biological Process | oxidation-reduction process | ||||
GO:0060154 | Biological Process | cellular process regulating host cell cycle in response to virus | ||||
GO:0005737 | Cellular Component | cytoplasm | ||||
GO:0016021 | Cellular Component | integral component of membrane | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0004497 | Molecular Function | monooxygenase activity | ||||
GO:0004842 | Molecular Function | ubiquitin-protein transferase activity | ||||
GO:0005506 | Molecular Function | iron ion binding | ||||
GO:0005525 | Molecular Function | GTP binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0008271 | Molecular Function | secondary active sulfate transmembrane transporter activity | ||||
GO:0008289 | Molecular Function | lipid binding | ||||
GO:0016705 | Molecular Function | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen | ||||
GO:0020037 | Molecular Function | heme binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 208 aa Download sequence Send to blast |
MAKKPSLGRQ KIAISKIPKK NHLQVTFSKR RSGLFKKASE LCTLCGVDIG IIVFSPASKV 60 FSFGHPEVEF IIDRFLAQDP APPDSGECRL IEAHRNANLR DLNGILTQVL EELEVERKRG 120 EALDEMRRES QRQCWWEAPI DELGLCELEQ LGGSMEELKK NVMRWINELM VDSCSPNGEI 180 AYESKPLEAN GAYNLGHVYN LHDQNGLF |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. Required for suppression of cellularization and promotion of nuclear proliferation during early endosperm development. The FERTILIZATION-INDEPENDENT SEED (FIS) polycomb complex is required for suppression of ALG62 expression at the end of the syncytial phase of endosperm development. {ECO:0000269|PubMed:18334668}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010027322.1 | 1e-152 | PREDICTED: agamous-like MADS-box protein AGL62 | ||||
Swissprot | Q9FKK2 | 6e-53 | AGL62_ARATH; Agamous-like MADS-box protein AGL62 | ||||
TrEMBL | A0A059B7H1 | 1e-120 | A0A059B7H1_EUCGR; Uncharacterized protein | ||||
STRING | XP_010027322.1 | 1e-152 | (Eucalyptus grandis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G60440.1 | 6e-49 | AGAMOUS-like 62 |
Publications ? help Back to Top | |||
---|---|---|---|
|