PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC054956.60 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 160aa MW: 18177.2 Da PI: 5.3389 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 160.7 | 2.2e-50 | 3 | 98 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 eq+r+lPianv+rimk++lP akisk+ak+t+qec++efi+fvt+easd+c++e+rkt+ngdd++wal++lGf++y+e++ yl+kyre e+ek EcC054956.60 3 DEQERLLPIANVGRIMKEILPPSAKISKEAKQTIQECATEFIGFVTGEASDRCHKENRKTVNGDDICWALSNLGFDNYAEAMARYLHKYREYEREK 98 69*******************************************************************************************997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.8E-50 | 2 | 134 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.11E-39 | 5 | 134 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.8E-25 | 8 | 72 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 5.4E-17 | 36 | 54 | No hit | No description |
PRINTS | PR00615 | 5.4E-17 | 55 | 73 | No hit | No description |
PRINTS | PR00615 | 5.4E-17 | 74 | 92 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0008168 | Molecular Function | methyltransferase activity | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 160 aa Download sequence Send to blast |
MVDEQERLLP IANVGRIMKE ILPPSAKISK EAKQTIQECA TEFIGFVTGE ASDRCHKENR 60 KTVNGDDICW ALSNLGFDNY AEAMARYLHK YREYEREKNR SNSSNNNQTL ATSSGDNKDD 120 GELHLRIQEQ QVRQVETHQS LAPLEFQFID KGKSSTSEPA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 3e-39 | 2 | 93 | 6 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010043071.1 | 1e-117 | PREDICTED: nuclear transcription factor Y subunit B-4 | ||||
Swissprot | O04027 | 9e-54 | NFYB4_ARATH; Nuclear transcription factor Y subunit B-4 | ||||
TrEMBL | A0A059D4G7 | 1e-116 | A0A059D4G7_EUCGR; Uncharacterized protein | ||||
STRING | XP_010043071.1 | 1e-117 | (Eucalyptus grandis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 6e-51 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|