PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC054823.230 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 141aa MW: 16457.4 Da PI: 6.5169 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 36.2 | 1.3e-11 | 49 | 97 | 2 | 50 |
XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 +++++ rr+++NR +A rsR RKk+ +eeL+++ L N++Lk++le EcC054823.230 49 EDDRKRRRMESNRKSAARSRYRKKQHLEELTDELNRLGVVNRELKSRLE 97 678999***************************************9997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 2.5E-11 | 42 | 97 | No hit | No description |
SMART | SM00338 | 5.1E-15 | 48 | 112 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.231 | 50 | 113 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 2.8E-9 | 50 | 97 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 1.41E-10 | 52 | 103 | No hit | No description |
CDD | cd14702 | 5.56E-11 | 53 | 103 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 55 | 70 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0006468 | Biological Process | protein phosphorylation | ||||
GO:0006506 | Biological Process | GPI anchor biosynthetic process | ||||
GO:0006508 | Biological Process | proteolysis | ||||
GO:0006816 | Biological Process | calcium ion transport | ||||
GO:0007018 | Biological Process | microtubule-based movement | ||||
GO:0015074 | Biological Process | DNA integration | ||||
GO:0055114 | Biological Process | oxidation-reduction process | ||||
GO:0071805 | Biological Process | potassium ion transmembrane transport | ||||
GO:0016021 | Cellular Component | integral component of membrane | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0003777 | Molecular Function | microtubule motor activity | ||||
GO:0004185 | Molecular Function | serine-type carboxypeptidase activity | ||||
GO:0004190 | Molecular Function | aspartic-type endopeptidase activity | ||||
GO:0004506 | Molecular Function | squalene monooxygenase activity | ||||
GO:0004584 | Molecular Function | dolichyl-phosphate-mannose-glycolipid alpha-mannosyltransferase activity | ||||
GO:0004672 | Molecular Function | protein kinase activity | ||||
GO:0005388 | Molecular Function | calcium-transporting ATPase activity | ||||
GO:0005524 | Molecular Function | ATP binding | ||||
GO:0008017 | Molecular Function | microtubule binding | ||||
GO:0015079 | Molecular Function | potassium ion transmembrane transporter activity | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046872 | Molecular Function | metal ion binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity | ||||
GO:0050660 | Molecular Function | flavin adenine dinucleotide binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 141 aa Download sequence Send to blast |
MFCSDDPVHL QLLTYDELEE LLSTLESESP VSPNNSCSEG SNRTLSSAED DRKRRRMESN 60 RKSAARSRYR KKQHLEELTD ELNRLGVVNR ELKSRLEYAM TQFFTVQTEN ERLRSECASL 120 SARLSDLHWI LLAMQNHINP R |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 51 | 55 | RKRRR |
2 | 64 | 72 | ARSRYRKKQ |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010064706.1 | 1e-96 | PREDICTED: bZIP transcription factor 2 | ||||
TrEMBL | A0A218X7E6 | 5e-40 | A0A218X7E6_PUNGR; Uncharacterized protein | ||||
STRING | XP_010064706.1 | 4e-96 | (Eucalyptus grandis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G22850.2 | 4e-15 | basic leucine-zipper 6 |