PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC054678.140 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 159aa MW: 17511.9 Da PI: 8.2239 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 138 | 3.3e-43 | 9 | 108 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 +Ca+Ck+lrr+C+kdC++apyfp ++p+kfa+vhk+FGasn++k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg+i+ lq+q+++l+ +la+ EcC054678.140 9 PCASCKLLRRRCSKDCIFAPYFPPHDPHKFAIVHKVFGASNLSKMLQELPVNQRGDAVSSLVYEANARVRDPVYGCVGTISYLQNQVSELQLQLAA 104 7**********************************************************************************************9 PP DUF260 97 lkee 100 +++e EcC054678.140 105 AQAE 108 9876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 26.398 | 8 | 109 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 3.0E-43 | 9 | 106 | IPR004883 | Lateral organ boundaries, LOB |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046274 | Biological Process | lignin catabolic process | ||||
GO:0055114 | Biological Process | oxidation-reduction process | ||||
GO:0071805 | Biological Process | potassium ion transmembrane transport | ||||
GO:0005829 | Cellular Component | cytosol | ||||
GO:0009506 | Cellular Component | plasmodesma | ||||
GO:0016020 | Cellular Component | membrane | ||||
GO:0048046 | Cellular Component | apoplast | ||||
GO:0005507 | Molecular Function | copper ion binding | ||||
GO:0005515 | Molecular Function | protein binding | ||||
GO:0015079 | Molecular Function | potassium ion transmembrane transporter activity | ||||
GO:0016747 | Molecular Function | transferase activity, transferring acyl groups other than amino-acyl groups | ||||
GO:0016758 | Molecular Function | transferase activity, transferring hexosyl groups | ||||
GO:0016788 | Molecular Function | hydrolase activity, acting on ester bonds | ||||
GO:0052716 | Molecular Function | hydroquinone:oxygen oxidoreductase activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 159 aa Download sequence Send to blast |
MGGSSGSSPC ASCKLLRRRC SKDCIFAPYF PPHDPHKFAI VHKVFGASNL SKMLQELPVN 60 QRGDAVSSLV YEANARVRDP VYGCVGTISY LQNQVSELQL QLAAAQAEVL SLQMHQKPHL 120 VQQDRETSFL MAGDNFNSVS HYIAASVIQD PLKRESFST |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 5e-47 | 5 | 110 | 7 | 112 | LOB family transfactor Ramosa2.1 |
5ly0_B | 5e-47 | 5 | 110 | 7 | 112 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010045372.1 | 1e-116 | PREDICTED: LOB domain-containing protein 12 | ||||
Swissprot | Q8LBW3 | 1e-69 | LBD12_ARATH; LOB domain-containing protein 12 | ||||
TrEMBL | A0A059DAN8 | 1e-114 | A0A059DAN8_EUCGR; Uncharacterized protein | ||||
STRING | XP_010045372.1 | 1e-115 | (Eucalyptus grandis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G30130.1 | 2e-55 | LBD family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|