PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC054379.50 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 109aa MW: 12699.8 Da PI: 10.1126 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 102.1 | 2.1e-32 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s EcC054379.50 9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 59 79***********************************************96 PP | |||||||
2 | K-box | 16.7 | 3e-07 | 81 | 109 | 8 | 36 |
K-box 8 sleeakaeslqqelakLkkeienLqreqR 36 + + +++++++q++ kLk+++e Lqr+qR EcC054379.50 81 NCSINEMQNSYQDYLKLKARVEVLQRSQR 109 477899*********************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 33.726 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 2.0E-42 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.12E-43 | 2 | 78 | No hit | No description |
SuperFamily | SSF55455 | 2.35E-35 | 2 | 81 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.6E-34 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 4.7E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.6E-34 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.6E-34 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010215 | Biological Process | cellulose microfibril organization | ||||
GO:0016049 | Biological Process | cell growth | ||||
GO:0030244 | Biological Process | cellulose biosynthetic process | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0031225 | Cellular Component | anchored component of membrane | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0005524 | Molecular Function | ATP binding | ||||
GO:0016757 | Molecular Function | transferase activity, transferring glycosyl groups | ||||
GO:0016866 | Molecular Function | intramolecular transferase activity | ||||
GO:0046983 | Molecular Function | protein dimerization activity | ||||
GO:0051499 | Molecular Function | D-aminoacyl-tRNA deacylase activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 109 aa Download sequence Send to blast |
MGRGKVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFCSS 60 SSMMKTIEKY QKCSYGSLET NCSINEMQNS YQDYLKLKAR VEVLQRSQR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 4e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_B | 4e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_C | 4e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_D | 4e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_A | 4e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_B | 4e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_C | 4e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_D | 4e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts redundantly with J2 to control meristem maturation and inflorescence architecture. {ECO:0000269|PubMed:28528644}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001289642.1 | 6e-74 | developmental protein SEPALLATA 1-like | ||||
Swissprot | Q7Y040 | 2e-63 | EJ2_SOLLC; MADS-box protein EJ2 | ||||
TrEMBL | O64935 | 1e-72 | O64935_EUCGR; MADS box protein | ||||
STRING | XP_010037259.1 | 2e-72 | (Eucalyptus grandis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G03710.3 | 2e-60 | MIKC_MADS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|