PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC054113.90 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | SRS | ||||||||
Protein Properties | Length: 111aa MW: 11574.7 Da PI: 4.3394 | ||||||||
Description | SRS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF702 | 84.8 | 2.1e-26 | 7 | 58 | 103 | 154 |
DUF702 103 sslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154 +slP +v+++avf+cvrv+svddge+e+aYq++v+igGhvfkG+Lyd+G+ee EcC054113.90 7 ESLPGQVRAPAVFKCVRVTSVDDGEDEYAYQAVVKIGGHVFKGFLYDRGVEE 58 67***********************************************997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF05142 | 1.0E-23 | 5 | 57 | IPR007818 | Protein of unknown function DUF702 |
TIGRFAMs | TIGR01624 | 4.4E-30 | 9 | 56 | IPR006511 | Lateral Root Primordium type 1, C-terminal |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006433 | Biological Process | prolyl-tRNA aminoacylation | ||||
GO:0006468 | Biological Process | protein phosphorylation | ||||
GO:0055114 | Biological Process | oxidation-reduction process | ||||
GO:0005737 | Cellular Component | cytoplasm | ||||
GO:0016020 | Cellular Component | membrane | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0004672 | Molecular Function | protein kinase activity | ||||
GO:0004827 | Molecular Function | proline-tRNA ligase activity | ||||
GO:0005506 | Molecular Function | iron ion binding | ||||
GO:0005515 | Molecular Function | protein binding | ||||
GO:0005524 | Molecular Function | ATP binding | ||||
GO:0016705 | Molecular Function | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen | ||||
GO:0016788 | Molecular Function | hydrolase activity, acting on ester bonds | ||||
GO:0016887 | Molecular Function | ATPase activity | ||||
GO:0020037 | Molecular Function | heme binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 111 aa Download sequence Send to blast |
MDASFKESLP GQVRAPAVFK CVRVTSVDDG EDEYAYQAVV KIGGHVFKGF LYDRGVEERE 60 DIMNLSDLHL GGGGGGDRNG ASSSSPIMDP SDVYASGGGL LGGSSYGNPI N |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influence vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM). Modulates root growth. {ECO:0000269|PubMed:16740146, ECO:0000269|PubMed:18835563}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Expression repressed by LDL1 via histone H3 and H4 deacetylation. {ECO:0000269|PubMed:18835563}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018719986.1 | 8e-72 | PREDICTED: protein LATERAL ROOT PRIMORDIUM 1 | ||||
Swissprot | Q94CK9 | 9e-37 | LRP1_ARATH; Protein LATERAL ROOT PRIMORDIUM 1 | ||||
TrEMBL | A0A059AB82 | 2e-70 | A0A059AB82_EUCGR; Uncharacterized protein | ||||
STRING | XP_010034259.1 | 9e-70 | (Eucalyptus grandis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G12330.2 | 3e-37 | Lateral root primordium (LRP) protein-related |
Publications ? help Back to Top | |||
---|---|---|---|
|