PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC053893.60 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | TALE | ||||||||
Protein Properties | Length: 128aa MW: 14967.8 Da PI: 9.7819 | ||||||||
Description | TALE family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 31.6 | 2.8e-10 | 74 | 109 | 20 | 55 |
HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 +k +yp+++++ LAk++gL+++q+ +WF N+R ++ EcC053893.60 74 NKWPYPTEADKIALAKSTGLDQKQINNWFINQRKRH 109 4679*****************************985 PP | |||||||
2 | ELK | 29.5 | 1.7e-10 | 29 | 50 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 +LK++LlrK++ ++++Lk EFs EcC053893.60 29 DLKDRLLRKFGNHISTLKLEFS 50 69*******************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03789 | 6.0E-7 | 29 | 50 | IPR005539 | ELK domain |
SMART | SM01188 | 6.9E-5 | 29 | 50 | IPR005539 | ELK domain |
PROSITE profile | PS51213 | 9.638 | 29 | 49 | IPR005539 | ELK domain |
PROSITE profile | PS50071 | 12.827 | 49 | 112 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 5.13E-20 | 50 | 123 | IPR009057 | Homeodomain-like |
SMART | SM00389 | 4.5E-14 | 51 | 116 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 1.8E-28 | 54 | 114 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 4.95E-12 | 61 | 113 | No hit | No description |
Pfam | PF05920 | 1.4E-17 | 69 | 108 | IPR008422 | Homeobox KN domain |
PROSITE pattern | PS00027 | 0 | 87 | 110 | IPR017970 | Homeobox, conserved site |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0006468 | Biological Process | protein phosphorylation | ||||
GO:0004672 | Molecular Function | protein kinase activity | ||||
GO:0005524 | Molecular Function | ATP binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 128 aa Download sequence Send to blast |
NEGDVSSDED FSGGEVEAPE TQPRGEDRDL KDRLLRKFGN HISTLKLEFS KKKKKGKLPK 60 EARQTLLEWW NVHNKWPYPT EADKIALAKS TGLDQKQINN WFINQRKRHW KPSENMQFAL 120 MDSIPGQY |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Plays a role in meristem function. Contributes to the shoot apical meristem (SAM) maintenance and organ separation by controlling boundary establishment in embryo in a CUC1, CUC2 and STM-dependent manner. Involved in maintaining cells in an undifferentiated, meristematic state. Probably binds to the DNA sequence 5'-TGAC-3'. {ECO:0000269|PubMed:16798887}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Seems to be repressed by AS2 and AS1 but induced by STM, CUC1 and CUC2. {ECO:0000269|PubMed:11311158, ECO:0000269|PubMed:16798887}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010023500.1 | 3e-89 | PREDICTED: homeobox protein knotted-1-like 6 | ||||
Refseq | XP_010023501.1 | 3e-89 | PREDICTED: homeobox protein knotted-1-like 6 | ||||
Swissprot | Q84JS6 | 4e-60 | KNAT6_ARATH; Homeobox protein knotted-1-like 6 | ||||
TrEMBL | A0A059B1M5 | 6e-88 | A0A059B1M5_EUCGR; Uncharacterized protein | ||||
STRING | XP_010023500.1 | 1e-88 | (Eucalyptus grandis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G23380.2 | 7e-54 | KNOTTED1-like homeobox gene 6 |
Publications ? help Back to Top | |||
---|---|---|---|
|