PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC052993.20
Organism
Eucalyptus camaldulensis
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family M-type_MADS
Protein Properties Length: 63aa    MW: 7233.4 Da    PI: 10.5434
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC052993.20genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF90.39.6e-291059251
                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
        SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                  +ien++nrqvt+skRrngi+KKA+EL vLCda+v+++++s + kl+ey+s
  EcC052993.20 10 KIENDTNRQVTYSKRRNGIFKKAHELTVLCDARVSILMLSGNKKLHEYIS 59
                  7***********************************************86 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.586161IPR002100Transcription factor, MADS-box
SMARTSM004328.3E-37160IPR002100Transcription factor, MADS-box
CDDcd002653.37E-33262No hitNo description
SuperFamilySSF554553.01E-29261IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-26323IPR002100Transcription factor, MADS-box
PfamPF003192.2E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-263859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006081Biological Processcellular aldehyde metabolic process
GO:0055114Biological Processoxidation-reduction process
GO:0005783Cellular Componentendoplasmic reticulum
GO:0016020Cellular Componentmembrane
GO:0003677Molecular FunctionDNA binding
GO:0004030Molecular Functionaldehyde dehydrogenase [NAD(P)+] activity
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 63 aa     Download sequence    Send to blast
MGRGKIEIQK IENDTNRQVT YSKRRNGIFK KAHELTVLCD ARVSILMLSG NKKLHEYISP  60
TTT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6bz1_A1e-15159159MEF2 CHIMERA
6bz1_B1e-15159159MEF2 CHIMERA
6bz1_C1e-15159159MEF2 CHIMERA
6bz1_D1e-15159159MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the genetic control of flower development. Is required for normal development of petals and stamens in the wild-type flower. Forms a heterodimer with PISTILLATA that is required for autoregulation of both AP3 and PI genes. AP3/PI heterodimer interacts with APETALA1 or SEPALLATA3 to form a ternary complex that could be responsible for the regulation of the genes involved in the flower development. AP3/PI heterodimer activates the expression of NAP. AP3/PI prevents GATA22/GNL and GATA21/GNC expression (PubMed:18417639). {ECO:0000269|PubMed:18417639, ECO:0000269|PubMed:8565821, ECO:0000269|PubMed:9489703}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Positively regulated by the meristem identity proteins APETALA1 and LEAFY with the cooperation of UFO. Repressed by silencing mediated by polycomb group (PcG) protein complex containing EMF1 and EMF2. {ECO:0000269|PubMed:11283333, ECO:0000269|PubMed:19783648}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010029721.15e-39PREDICTED: floral homeotic protein DEFICIENS
SwissprotP356321e-31AP3_ARATH; Floral homeotic protein APETALA 3
TrEMBLA0A059ARS41e-37A0A059ARS4_EUCGR; Uncharacterized protein
TrEMBLA0A059ASK81e-37A0A059ASK8_EUCGR; Uncharacterized protein
STRINGXP_010029721.12e-38(Eucalyptus grandis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54340.15e-34MIKC_MADS family protein
Publications ? help Back to Top
  1. Furner I,Ellis L,Bakht S,Mirza B,Sheikh M
    CAUT lines: a novel resource for studies of cell autonomy in Arabidopsis.
    Plant J., 2008. 53(4): p. 645-60
    [PMID:18269574]
  2. Jing D, et al.
    Two ancestral APETALA3 homologs from the basal angiosperm Magnolia wufengensis (Magnoliaceae) can affect flower development of Arabidopsis.
    Gene, 2014. 537(1): p. 100-7
    [PMID:24334124]
  3. Zhang Y, et al.
    A cucumber DELLA homolog CsGAIP may inhibit staminate development through transcriptional repression of B class floral homeotic genes.
    PLoS ONE, 2014. 9(3): p. e91804
    [PMID:24632777]
  4. Nakamura Y,Liu YC,Lin YC
    Floral glycerolipid profiles in homeotic mutants of Arabidopsis thaliana.
    Biochem. Biophys. Res. Commun., 2014. 450(4): p. 1272-5
    [PMID:24984150]
  5. Behrend A,Borchert T,Hohe A
    "The usual suspects"- analysis of transcriptome sequences reveals deviating B gene activity in C. vulgaris bud bloomers.
    BMC Plant Biol., 2015. 15: p. 8
    [PMID:25604890]
  6. Chen Z, et al.
    Overexpression of AtAP1M3 regulates flowering time and floral development in Arabidopsis and effects key flowering-related genes in poplar.
    Transgenic Res., 2015. 24(4): p. 705-15
    [PMID:25820621]
  7. Yunus IS, et al.
    Phosphatidic acid is a major phospholipid class in reproductive organs of Arabidopsis thaliana.
    Plant Signal Behav, 2015. 10(8): p. e1049790
    [PMID:26179579]
  8. Sun JJ, et al.
    CsAP3: A Cucumber Homolog to Arabidopsis APETALA3 with Novel Characteristics.
    Front Plant Sci, 2016. 7: p. 1181
    [PMID:27540391]