PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC052993.20 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 63aa MW: 7233.4 Da PI: 10.5434 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 90.3 | 9.6e-29 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 +ien++nrqvt+skRrngi+KKA+EL vLCda+v+++++s + kl+ey+s EcC052993.20 10 KIENDTNRQVTYSKRRNGIFKKAHELTVLCDARVSILMLSGNKKLHEYIS 59 7***********************************************86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 30.586 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 8.3E-37 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 3.37E-33 | 2 | 62 | No hit | No description |
SuperFamily | SSF55455 | 3.01E-29 | 2 | 61 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.5E-26 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.2E-24 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.5E-26 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.5E-26 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006081 | Biological Process | cellular aldehyde metabolic process | ||||
GO:0055114 | Biological Process | oxidation-reduction process | ||||
GO:0005783 | Cellular Component | endoplasmic reticulum | ||||
GO:0016020 | Cellular Component | membrane | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0004030 | Molecular Function | aldehyde dehydrogenase [NAD(P)+] activity | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 63 aa Download sequence Send to blast |
MGRGKIEIQK IENDTNRQVT YSKRRNGIFK KAHELTVLCD ARVSILMLSG NKKLHEYISP 60 TTT |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6bz1_A | 1e-15 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
6bz1_B | 1e-15 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
6bz1_C | 1e-15 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
6bz1_D | 1e-15 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the genetic control of flower development. Is required for normal development of petals and stamens in the wild-type flower. Forms a heterodimer with PISTILLATA that is required for autoregulation of both AP3 and PI genes. AP3/PI heterodimer interacts with APETALA1 or SEPALLATA3 to form a ternary complex that could be responsible for the regulation of the genes involved in the flower development. AP3/PI heterodimer activates the expression of NAP. AP3/PI prevents GATA22/GNL and GATA21/GNC expression (PubMed:18417639). {ECO:0000269|PubMed:18417639, ECO:0000269|PubMed:8565821, ECO:0000269|PubMed:9489703}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Positively regulated by the meristem identity proteins APETALA1 and LEAFY with the cooperation of UFO. Repressed by silencing mediated by polycomb group (PcG) protein complex containing EMF1 and EMF2. {ECO:0000269|PubMed:11283333, ECO:0000269|PubMed:19783648}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010029721.1 | 5e-39 | PREDICTED: floral homeotic protein DEFICIENS | ||||
Swissprot | P35632 | 1e-31 | AP3_ARATH; Floral homeotic protein APETALA 3 | ||||
TrEMBL | A0A059ARS4 | 1e-37 | A0A059ARS4_EUCGR; Uncharacterized protein | ||||
TrEMBL | A0A059ASK8 | 1e-37 | A0A059ASK8_EUCGR; Uncharacterized protein | ||||
STRING | XP_010029721.1 | 2e-38 | (Eucalyptus grandis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G54340.1 | 5e-34 | MIKC_MADS family protein |