PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC046766.20 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 147aa MW: 16985.5 Da PI: 6.6612 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 132.7 | 1.3e-41 | 63 | 138 | 2 | 77 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 Cq+e+C++d+++ak+yhrrhkvCe+h+ka+v++v+gl+qrfCqqCsrfhelsefDe+krsCrrrLa+hnerrrk++ EcC046766.20 63 CQAENCSVDMTDAKRYHRRHKVCEFHAKASVAMVAGLRQRFCQQCSRFHELSEFDETKRSCRRRLAGHNERRRKSS 138 **************************************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PIRSF | PIRSF037575 | 2.3E-56 | 6 | 147 | IPR017238 | Squamosa promoter-binding protein |
Gene3D | G3DSA:4.10.1100.10 | 2.4E-33 | 59 | 124 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 32.214 | 60 | 137 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 3.53E-39 | 61 | 141 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 2.6E-31 | 63 | 136 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009908 | Biological Process | flower development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 147 aa Download sequence Send to blast |
MESPNFGEDE RSLKDNKMEY EDLEEEEEDD DESSEADRKR ARAATRSTRK GGSCSGWAPP 60 PSCQAENCSV DMTDAKRYHR RHKVCEFHAK ASVAMVAGLR QRFCQQCSRF HELSEFDETK 120 RSCRRRLAGH NERRRKSSYD NQGEGSN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 1e-36 | 55 | 136 | 3 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010057392.1 | 8e-90 | PREDICTED: squamosa promoter-binding-like protein 3 | ||||
Swissprot | Q38741 | 3e-45 | SBP1_ANTMA; Squamosa promoter-binding protein 1 | ||||
TrEMBL | A0A059C8J5 | 2e-88 | A0A059C8J5_EUCGR; Squamosa promoter-binding-like protein | ||||
STRING | XP_010057392.1 | 3e-89 | (Eucalyptus grandis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G15270.1 | 3e-44 | squamosa promoter binding protein-like 5 |
Publications ? help Back to Top | |||
---|---|---|---|
|