 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
EcC045655.50 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
| Family |
SRS |
| Protein Properties |
Length: 136aa MW: 14288.6 Da PI: 4.1112 |
| Description |
SRS family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| EcC045655.50 | genome | ECGD | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | DUF702 | 90 | 5.3e-28 | 3 | 55 | 102 | 154 |
DUF702 102 tsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
+ ++P+ev+s+a+frcvrvss+dd+++++aYqtav+igGhvfkGiLydqG+++
EcC045655.50 3 MGNFPAEVNSSALFRCVRVSSIDDNDDQYAYQTAVNIGGHVFKGILYDQGPDH 55
678************************************************98 PP
|
| Gene Ontology ? help Back to Top |
| GO Term |
GO Category |
GO Description |
| GO:0000154 | Biological Process | rRNA modification |
| GO:0045454 | Biological Process | cell redox homeostasis |
| GO:0005774 | Cellular Component | vacuolar membrane |
| GO:0005783 | Cellular Component | endoplasmic reticulum |
| GO:0005794 | Cellular Component | Golgi apparatus |
| GO:0000179 | Molecular Function | rRNA (adenine-N6,N6-)-dimethyltransferase activity |
| GO:0003677 | Molecular Function | DNA binding |
| GO:0009055 | Molecular Function | electron carrier activity |
| GO:0015035 | Molecular Function | protein disulfide oxidoreductase activity |
| Sequence ? help Back to Top |
| Protein Sequence Length: 136 aa
Download sequence Send
to blast |
LEMGNFPAEV NSSALFRCVR VSSIDDNDDQ YAYQTAVNIG GHVFKGILYD QGPDHANYMA 60
AGESSSVHLG GDGSGGIQQL SLIAAAAAGD TMTTQEDGNN NAAVSQVAAP LFDPSSMYPT 120
QLNNFMGGAQ FFPHPR
|
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Transcription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influences vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM). {ECO:0000269|PubMed:12361963, ECO:0000269|PubMed:16740145, ECO:0000269|PubMed:16740146, ECO:0000269|PubMed:18811619, ECO:0000269|PubMed:20154152, ECO:0000269|PubMed:22318676}. |
| UniProt | Transcription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influences vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM). Suppressor of the gibberellin (GA) signal transduction. {ECO:0000269|PubMed:10368174, ECO:0000269|PubMed:11706176, ECO:0000269|PubMed:16740146}. |
| Regulation -- Description ? help
Back to Top |
| Source |
Description |
| UniProt | INDUCTION: Regulated by ESR1 and ESR2. {ECO:0000269|PubMed:21976484}. |
| Best hit in Arabidopsis thaliana ? help
Back to Top |
| Hit ID |
E-value |
Description |
| AT3G51060.1 | 2e-33 | Lateral root primordium (LRP) protein-related |
| Publications
? help Back to Top |
- Islam MA, et al.
Overexpression of the AtSHI gene in poinsettia, Euphorbia pulcherrima, results in compact plants.
PLoS ONE, 2013. 8(1): p. e53377
[PMID:23308204] - Pfannebecker KC,Lange M,Rupp O,Becker A
An Evolutionary Framework for Carpel Developmental Control Genes.
Mol. Biol. Evol., 2017. 34(2): p. 330-348
[PMID:28049761] - Estornell LH,Landberg K,Cierlik I,Sundberg E
SHI/STY Genes Affect Pre- and Post-meiotic Anther Processes in Auxin Sensing Domains in Arabidopsis.
Front Plant Sci, 2018. 9: p. 150
[PMID:29491878]
|
