PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC033626.10 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 114aa MW: 13020.8 Da PI: 7.1889 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 167.3 | 2e-52 | 13 | 108 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 +eqdr+lPianv+rimk++lP nakisk+aket+qecvsefi+fvt+eas+kc++e+rkt+ngdd++wa+ tlGf++y+ pl+ yl+ yr+leg+k EcC033626.10 13 KEQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFIGFVTGEASEKCRKERRKTVNGDDICWAMKTLGFDNYAGPLRRYLHIYRDLEGNK 108 89*******************************************************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.2E-49 | 9 | 112 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.07E-37 | 15 | 111 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.5E-27 | 18 | 82 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 8.7E-15 | 46 | 64 | No hit | No description |
PRINTS | PR00615 | 8.7E-15 | 65 | 83 | No hit | No description |
PRINTS | PR00615 | 8.7E-15 | 84 | 102 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 114 aa Download sequence Send to blast |
MEDNIGSEDG SIKEQDRLLP IANVGRIMKQ ILPPNAKISK EAKETMQECV SEFIGFVTGE 60 ASEKCRKERR KTVNGDDICW AMKTLGFDNY AGPLRRYLHI YRDLEGNKAN QDRQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 2e-43 | 12 | 103 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 2e-43 | 12 | 103 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010037376.1 | 5e-78 | PREDICTED: nuclear transcription factor Y subunit B-5 | ||||
Swissprot | O82248 | 1e-56 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A059D1M2 | 1e-76 | A0A059D1M2_EUCGR; Uncharacterized protein | ||||
STRING | XP_010037376.1 | 2e-77 | (Eucalyptus grandis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 4e-59 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|