PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC026665.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 128aa    MW: 14575.8 Da    PI: 11.1035
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC026665.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.61.2e-27252556
       G2-like  5 rWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56
                  +WtpeLH+rFv+aveqL G +kA+P++ilelm++++Lt+++++SHLQkYR++
  EcC026665.10  2 DWTPELHRRFVQAVEQL-GLDKAVPSRILELMGIDCLTRHNIASHLQKYRSH 52
                  7****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.779154IPR017930Myb domain
TIGRFAMsTIGR015572.2E-26152IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.603.1E-26255IPR009057Homeodomain-like
SuperFamilySSF466891.61E-18255IPR009057Homeodomain-like
PfamPF002491.2E-8250IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 128 aa     Download sequence    Send to blast
VDWTPELHRR FVQAVEQLGL DKAVPSRILE LMGIDCLTRH NIASHLQKYR SHRKHMLARE  60
AEAANWSQRR HTHGNGGHKM RPDTMLVMSH STTPTNGSPW LAPATLGFPP VTPMPPHFRP  120
LHVWGHPP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A4e-16150857ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that functions with GLK2 to promote chloroplast development. Acts as an activator of nuclear photosynthetic genes involved in chlorophyll biosynthesis, light harvesting, and electron transport. Acts in a cell-autonomous manner to coordinate and maintain the photosynthetic apparatus within individual cells. May function in photosynthetic capacity optimization by integrating responses to variable environmental and endogenous cues (PubMed:11828027, PubMed:12220263, PubMed:17533111, PubMed:18643989, PubMed:19376934, PubMed:19383092, PubMed:19726569). Prevents premature senescence (PubMed:23459204). {ECO:0000269|PubMed:11828027, ECO:0000269|PubMed:12220263, ECO:0000269|PubMed:17533111, ECO:0000269|PubMed:18643989, ECO:0000269|PubMed:19376934, ECO:0000269|PubMed:19383092, ECO:0000269|PubMed:19726569, ECO:0000269|PubMed:23459204}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By light. Repressed by BZR2. {ECO:0000269|PubMed:12220263, ECO:0000269|PubMed:21214652}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010052247.18e-88PREDICTED: transcription activator GLK1
SwissprotQ9SIV35e-46GLK1_ARATH; Transcription activator GLK1
TrEMBLA0A059DGJ02e-86A0A059DGJ0_EUCGR; Uncharacterized protein
STRINGXP_010052247.13e-87(Eucalyptus grandis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22092773
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.12e-48GBF's pro-rich region-interacting factor 1
Publications ? help Back to Top
  1. Leister D,Kleine T
    Definition of a core module for the nuclear retrograde response to altered organellar gene expression identifies GLK overexpressors as gun mutants.
    Physiol Plant, 2016. 157(3): p. 297-309
    [PMID:26876646]
  2. Nagatoshi Y, et al.
    GOLDEN 2-LIKE transcription factors for chloroplast development affect ozone tolerance through the regulation of stomatal movement.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(15): p. 4218-23
    [PMID:27035938]
  3. Tokumaru M, et al.
    Ubiquitin-Proteasome Dependent Regulation of the GOLDEN2-LIKE 1 Transcription Factor in Response to Plastid Signals.
    Plant Physiol., 2017. 173(1): p. 524-535
    [PMID:27821720]
  4. Ni F, et al.
    Turnip Yellow Mosaic Virus P69 Interacts with and Suppresses GLK Transcription Factors to Cause Pale-Green Symptoms in Arabidopsis.
    Mol Plant, 2017. 10(5): p. 764-766
    [PMID:27964999]
  5. Wang H,Seo JK,Gao S,Cui X,Jin H
    Silencing of AtRAP, a target gene of a bacteria-induced small RNA, triggers antibacterial defense responses through activation of LSU2 and down-regulation of GLK1.
    New Phytol., 2017. 215(3): p. 1144-1155
    [PMID:28656601]