PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC023815.30 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 169aa MW: 19101 Da PI: 5.1462 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 158.3 | 1.2e-49 | 3 | 98 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 eq+++lPianv+rimk +lP akisk+ak+t+qec+sefisfvt+easdkc++e+rkt+ngdd++wal++lGf+dy+e++ yl+kyre e+e+ EcC023815.30 3 DEQEKLLPIANVGRIMKLILPPSAKISKEAKQTIQECASEFISFVTGEASDKCHKENRKTVNGDDICWALSSLGFDDYAEAIVRYLHKYREHESER 98 69******************************************************************************************9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 3.3E-50 | 2 | 132 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.42E-37 | 5 | 109 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.1E-25 | 9 | 72 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 4.1E-18 | 36 | 54 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 39 | 55 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 4.1E-18 | 55 | 73 | No hit | No description |
PRINTS | PR00615 | 4.1E-18 | 74 | 92 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0006508 | Biological Process | proteolysis | ||||
GO:0055114 | Biological Process | oxidation-reduction process | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0004252 | Molecular Function | serine-type endopeptidase activity | ||||
GO:0016702 | Molecular Function | oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046872 | Molecular Function | metal ion binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 169 aa Download sequence Send to blast |
MVDEQEKLLP IANVGRIMKL ILPPSAKISK EAKQTIQECA SEFISFVTGE ASDKCHKENR 60 KTVNGDDICW ALSSLGFDDY AEAIVRYLHK YREHESERAN CKQQTSKARN VTGRHDHEDK 120 VEGEDDDDDD DEGSCHTDSQ RGKGITSTCH RHPAPLEFRI IDRNETSPS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 1e-40 | 2 | 93 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 1e-40 | 2 | 93 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010025198.1 | 1e-124 | PREDICTED: nuclear transcription factor Y subunit B-5 | ||||
Swissprot | O82248 | 5e-52 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A059B7C7 | 1e-123 | A0A059B7C7_EUCGR; Uncharacterized protein | ||||
STRING | XP_010025198.1 | 1e-124 | (Eucalyptus grandis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 2e-54 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|