PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC023257.10 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | G2-like | ||||||||
Protein Properties | Length: 49aa MW: 5380.33 Da PI: 10.3689 | ||||||||
Description | G2-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 53 | 7.8e-17 | 4 | 33 | 26 | 55 |
G2-like 26 kAtPktilelmkvkgLtlehvkSHLQkYRl 55 +AtPk +l+lm+v gL+++hvkSHLQ+YR+ EcC023257.10 4 EATPKLVLQLMNVRGLSIAHVKSHLQMYRS 33 6****************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
TIGRFAMs | TIGR01557 | 6.1E-12 | 3 | 35 | IPR006447 | Myb domain, plants |
Gene3D | G3DSA:1.10.10.60 | 3.2E-15 | 3 | 34 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 4.12E-6 | 4 | 34 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0002229 | Biological Process | defense response to oomycetes | ||||
GO:0006855 | Biological Process | drug transmembrane transport | ||||
GO:0016020 | Cellular Component | membrane | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0015238 | Molecular Function | drug transmembrane transporter activity | ||||
GO:0015297 | Molecular Function | antiporter activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 49 aa Download sequence Send to blast |
MGTEATPKLV LQLMNVRGLS IAHVKSHLQM YRSKKLDDSG QGKLGTLLD |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021596592.1 | 5e-18 | probable transcription factor KAN2 | ||||
Refseq | XP_028769809.1 | 2e-18 | putative Myb family transcription factor At1g14600, partial | ||||
TrEMBL | A0A2P6RUQ3 | 4e-18 | A0A2P6RUQ3_ROSCH; Putative transcription factor MYB-HB-like family | ||||
STRING | VIT_12s0028g02080.t01 | 4e-17 | (Vitis vinifera) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G38300.1 | 5e-18 | G2-like family protein |