PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC022141.10 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 71aa MW: 8094.25 Da PI: 4.5639 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 25.9 | 2.6e-08 | 37 | 70 | 2 | 35 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHH CS HSF_DNA-bind 2 Flkklyeiledeelkeliswsengnsfvvldeee 35 Fl+k+y +++d+++++lisw+++g++f+ + e EcC022141.10 37 FLMKTYMLMNDPSVDDLISWNKDGTTFIAWRLAE 70 9***************************998765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.10 | 1.5E-7 | 30 | 69 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SuperFamily | SSF46785 | 1.1E-6 | 35 | 67 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
Pfam | PF00447 | 8.0E-5 | 37 | 67 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 71 aa Download sequence Send to blast |
LRVSWGLEFE RHPWGPMPAE QTGDSPVVGA SQRSLPFLMK TYMLMNDPSV DDLISWNKDG 60 TTFIAWRLAE L |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010055608.2 | 3e-21 | PREDICTED: heat stress transcription factor B-2b | ||||
TrEMBL | A0A059C1N5 | 7e-20 | A0A059C1N5_EUCGR; Uncharacterized protein | ||||
STRING | XP_010055608.1 | 2e-20 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM965 | 28 | 111 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G11660.1 | 5e-14 | HSF family protein |