PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC019561.80 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 116aa MW: 12591.3 Da PI: 8.4705 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 155.1 | 1.2e-48 | 1 | 83 | 13 | 95 |
NF-YB 13 vsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 +srimkk+lPan+ki+kdak+tvqecvsefisf+tseasdkcq+ekrktingddllwa+atlGfe+y+eplkvyl++yre ++ EcC019561.80 1 ISRIMKKALPANGKIAKDAKDTVQECVSEFISFITSEASDKCQKEKRKTINGDDLLWAMATLGFEEYIEPLKVYLARYREGDT 83 79*****************************************************************************9665 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF47113 | 5.12E-34 | 1 | 87 | IPR009072 | Histone-fold |
Gene3D | G3DSA:1.10.20.10 | 8.0E-45 | 1 | 86 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.2E-24 | 1 | 59 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 8.7E-22 | 23 | 41 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 26 | 42 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 8.7E-22 | 42 | 60 | No hit | No description |
PRINTS | PR00615 | 8.7E-22 | 61 | 79 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0006412 | Biological Process | translation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005840 | Cellular Component | ribosome | ||||
GO:0016021 | Cellular Component | integral component of membrane | ||||
GO:0000166 | Molecular Function | nucleotide binding | ||||
GO:0003735 | Molecular Function | structural constituent of ribosome | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 116 aa Download sequence Send to blast |
ISRIMKKALP ANGKIAKDAK DTVQECVSEF ISFITSEASD KCQKEKRKTI NGDDLLWAMA 60 TLGFEEYIEP LKVYLARYRE GDTKGSARGG DGSARKDISG GQPGQNVQVC SSVSSL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 3e-40 | 1 | 80 | 14 | 93 | NF-YB |
4awl_B | 3e-40 | 1 | 80 | 15 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 3e-40 | 1 | 80 | 15 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010067258.1 | 3e-73 | PREDICTED: nuclear transcription factor Y subunit B-1 | ||||
Swissprot | Q8VYK4 | 1e-58 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | D7TMF3 | 3e-67 | D7TMF3_VITVI; Uncharacterized protein | ||||
STRING | XP_010067258.1 | 1e-72 | (Eucalyptus grandis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G38880.7 | 6e-62 | nuclear factor Y, subunit B1 |
Publications ? help Back to Top | |||
---|---|---|---|
|