PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC018717.40 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 122aa MW: 13437.2 Da PI: 11.9146 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 40.1 | 8.5e-13 | 27 | 74 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g W+ +Ede l ++v++ Ggg+W+ + r+ ++ R++k+ ++rw ++l EcC018717.40 27 KGMWSRQEDEMLTKYVRRNGGGNWNMVQRHTPLLRCGKSYRLRWANHL 74 688*****************************99**********9996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 17.237 | 22 | 78 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.2E-17 | 22 | 77 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.1E-6 | 26 | 76 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.99E-19 | 28 | 103 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.13E-6 | 30 | 74 | No hit | No description |
Pfam | PF13921 | 2.7E-10 | 30 | 90 | No hit | No description |
PROSITE profile | PS50090 | 4.913 | 75 | 122 | IPR017877 | Myb-like domain |
Gene3D | G3DSA:1.10.10.60 | 9.9E-10 | 78 | 109 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0055114 | Biological Process | oxidation-reduction process | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 122 aa Download sequence Send to blast |
MNGGGGGGGR GGRGGGGEER PKKIRKKGMW SRQEDEMLTK YVRRNGGGNW NMVQRHTPLL 60 RCGKSYRLRW ANHLRPDLKK GAFSPEKESL VARLHAKHGN KWAHKASQVR ASSSSSSSQA 120 LS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 7e-13 | 27 | 106 | 4 | 82 | MYB PROTO-ONCOGENE PROTEIN |
1mse_C | 7e-13 | 27 | 106 | 4 | 82 | C-Myb DNA-Binding Domain |
1msf_C | 7e-13 | 27 | 106 | 4 | 82 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 10 | 16 | GGRGGGG |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator (PubMed:24278028). Binds to 5'-CAACTGTC-3' and/or 5'-TAACAAA-3' motif in target gene promoter to promote their expression (By similarity). Together with MYB101 and MYB120, functions as a male factor that controls pollen tube-synergid interaction in fertilization. Required for pollen tube growth arrest and sperm cell release in the female gametophyte, probably via the regulation of pollen tube-specific gene expression (PubMed:24278028, PubMed:23791732). {ECO:0000250|UniProtKB:O80883, ECO:0000269|PubMed:23791732, ECO:0000269|PubMed:24278028}. | |||||
UniProt | Transcription activator (PubMed:24278028, PubMed:25268707). Binds to 5'-CAACTGTC-3' and/or 5'-TAACAAA-3' motif in target gene promoter (e.g. alpha-amylase) to promote their expression (PubMed:11743113). Positive regulator of abscisic acid (ABA) responses leading to growth arrest during seed germination (PubMed:17217461). Promotes the expression of aleurone-related genes (e.g. CP1, CP, GASA1, BXL1 and BXL2) in seeds. Together with MYB33 and MYB65, promotes the programmed cell death (PCD) leading to vacuolation of protein storage vacuoles (PSVs) in the aleurone layers during seed germination (PubMed:20699403). Maybe involved in the regulation of leaves lamina morphogenesis (PubMed:25268707). Involved in pollen grain development (PubMed:22101548). Together with MYB97 and MYB120, functions as a male factor that controls pollen tube-synergid interaction in fertilization. Required for pollen tube growth arrest and sperm cell release in the female gametophyte, probably via the regulation of pollen tube-specific gene expression (PubMed:24278028, PubMed:23791732). {ECO:0000269|PubMed:11743113, ECO:0000269|PubMed:17217461, ECO:0000269|PubMed:20699403, ECO:0000269|PubMed:22101548, ECO:0000269|PubMed:23791732, ECO:0000269|PubMed:24278028, ECO:0000269|PubMed:25268707}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed in germinating seeds by microRNA159 (miR159)-mediated cleavage in an abscisic acid (ABA) and ABI3-dependent manner, probably to desensitize hormone signaling during seedling stress responses (PubMed:15226253, PubMed:17217461). Induced by increased upon gibberellic acid (GA) treatment (PubMed:20699403). {ECO:0000269|PubMed:15226253, ECO:0000269|PubMed:17217461, ECO:0000269|PubMed:20699403}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018720345.1 | 3e-47 | PREDICTED: myb-related protein Myb4-like | ||||
Swissprot | O80883 | 4e-33 | MB101_ARATH; Transcription factor MYB101 | ||||
Swissprot | Q9S773 | 2e-33 | MYB97_ARATH; Transcription factor MYB97 | ||||
TrEMBL | A0A067L3R9 | 5e-35 | A0A067L3R9_JATCU; MYB family protein | ||||
STRING | XP_010038599.1 | 2e-46 | (Eucalyptus grandis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G32460.1 | 3e-35 | myb domain protein 101 |
Publications ? help Back to Top | |||
---|---|---|---|
|