PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC008121.10 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | Nin-like | ||||||||
Protein Properties | Length: 100aa MW: 11670.9 Da PI: 10.7634 | ||||||||
Description | Nin-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | RWP-RK | 64.9 | 1.3e-20 | 18 | 61 | 6 | 49 |
RWP-RK 6 sledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRki 49 +l d+ yF+lpi++A+ L +c+Tv+K+iCR+ G+ RWP+Rk+ EcC008121.10 18 TLADVGGYFHLPIEKASERLHLCPTVVKKICRKGGVGRWPYRKV 61 6889999************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51519 | 12.969 | 4 | 85 | IPR003035 | RWP-RK domain |
Pfam | PF02042 | 8.4E-18 | 18 | 61 | IPR003035 | RWP-RK domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 100 aa Download sequence Send to blast |
GCIYVLRLVQ RERAEKRTLA DVGGYFHLPI EKASERLHLC PTVVKKICRK GGVGRWPYRK 60 VTLPFVSLSS RIEICPSKIF HLSQILVFCR FNVLRERSWN |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018718902.1 | 7e-29 | PREDICTED: protein RKD5 isoform X2 | ||||
TrEMBL | A0A059AAH1 | 2e-27 | A0A059AAH1_EUCGR; Uncharacterized protein | ||||
STRING | XP_010050417.1 | 1e-35 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4076 | 23 | 42 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G76350.1 | 8e-10 | Nin-like family protein |