PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC005080.20 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 41aa MW: 5006.92 Da PI: 11.2557 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 37.9 | 4e-12 | 1 | 37 | 9 | 45 |
CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 9 rkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaL 45 r +NR AA rsR+RKka+++eLe k+k L +e ++L EcC005080.20 1 RQLRNRDAAVRSRERKKAYVKELEVKSKYLWGECRRL 37 789*************************999887665 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 3.0E-10 | 1 | 37 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 1 | 15 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 8.806 | 1 | 37 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 7.9E-10 | 1 | 35 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 1.06E-9 | 1 | 37 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 41 aa Download sequence Send to blast |
RQLRNRDAAV RSRERKKAYV KELEVKSKYL WGECRRLGML L |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011654291.1 | 2e-16 | PREDICTED: bZIP transcription factor 60 | ||||
TrEMBL | A0A058ZRB7 | 5e-15 | A0A058ZRB7_EUCGR; Uncharacterized protein | ||||
TrEMBL | A0A4D6N020 | 6e-15 | A0A4D6N020_VIGUN; Uncharacterized protein | ||||
STRING | XP_004145607.1 | 3e-16 | (Cucumis sativus) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G42990.1 | 2e-08 | basic region/leucine zipper motif 60 |