PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC000329.10 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 120aa MW: 13506.3 Da PI: 5.281 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 163.8 | 2.3e-51 | 13 | 108 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 +eqdr+lPianv+rimk++lP nakisk+aket+q+cvsefi+fvtseas+kcqre+rkt+ngdd++ a+ tlGf+dy+ l+ yl+kyrel gek EcC000329.10 13 KEQDRLLPIANVGRIMKQILPPNAKISKEAKETMQDCVSEFIGFVTSEASEKCQRERRKTVNGDDICCAMETLGFDDYAGMLRRYLHKYRELGGEK 108 89******************************************************************************************9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.1E-49 | 10 | 118 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.19E-37 | 15 | 117 | IPR009072 | Histone-fold |
Pfam | PF00808 | 6.9E-27 | 18 | 82 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.9E-16 | 46 | 64 | No hit | No description |
PRINTS | PR00615 | 1.9E-16 | 65 | 83 | No hit | No description |
PRINTS | PR00615 | 1.9E-16 | 84 | 102 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 120 aa Download sequence Send to blast |
MVDNIGANDG SIKEQDRLLP IANVGRIMKQ ILPPNAKISK EAKETMQDCV SEFIGFVTSE 60 ASEKCQRERR KTVNGDDICC AMETLGFDDY AGMLRRYLHK YRELGGEKAN QDKAMNSTEQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 9e-45 | 12 | 103 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 9e-45 | 12 | 103 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010037376.1 | 8e-70 | PREDICTED: nuclear transcription factor Y subunit B-5 | ||||
Swissprot | O82248 | 3e-54 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A059D1L5 | 2e-80 | A0A059D1L5_EUCGR; Uncharacterized protein | ||||
STRING | XP_010037234.1 | 5e-81 | (Eucalyptus grandis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 1e-56 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|