PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Dusal.0433s00010.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Dunaliellaceae; Dunaliella
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 154aa MW: 16569.7 Da PI: 6.2635 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 169 | 5.7e-53 | 10 | 104 | 2 | 96 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90 +eqdr+lPian+srimkk+lP+naki+kdake++q+cvsefisf+tseasdkc rekrktingddllwa++tlGfe y+epl++yl+k+ Dusal.0433s00010.1.p 10 HEQDRYLPIANISRIMKKTLPGNAKIAKDAKEITQDCVSEFISFITSEASDKCLREKRKTINGDDLLWAMSTLGFESYMEPLRLYLQKF 98 69*************************************************************************************** PP NF-YB 91 relege 96 r++e+e Dusal.0433s00010.1.p 99 RHAEAE 104 **9987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.8E-51 | 9 | 115 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 5.43E-38 | 12 | 115 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.8E-26 | 15 | 79 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.8E-20 | 43 | 61 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 46 | 62 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.8E-20 | 62 | 80 | No hit | No description |
PRINTS | PR00615 | 1.8E-20 | 81 | 99 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 154 aa Download sequence Send to blast |
MAESGGGASH EQDRYLPIAN ISRIMKKTLP GNAKIAKDAK EITQDCVSEF ISFITSEASD 60 KCLREKRKTI NGDDLLWAMS TLGFESYMEP LRLYLQKFRH AEAEASNKGD PKKDAAHPSF 120 LQANPQGMVP AGFMPQSGAT SASAGLEEPS SSS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 2e-46 | 10 | 99 | 3 | 92 | NF-YB |
4awl_B | 2e-46 | 10 | 99 | 4 | 93 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 2e-46 | 10 | 99 | 4 | 93 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KP869114 | 1e-157 | KP869114.1 Dunaliella salina nuclear factor Y B subunit (NF-YB) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020182576.1 | 5e-57 | nuclear transcription factor Y subunit B-2-like | ||||
Refseq | XP_020182577.1 | 5e-57 | nuclear transcription factor Y subunit B-2-like | ||||
Swissprot | P25209 | 7e-55 | NFYB_MAIZE; Nuclear transcription factor Y subunit B | ||||
TrEMBL | A0A0K2GUN6 | 1e-102 | A0A0K2GUN6_DUNSA; Nuclear factor Y B subunit | ||||
STRING | XP_002949581.1 | 3e-56 | (Volvox carteri) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Chlorophytae | OGCP2023 | 16 | 16 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 5e-57 | nuclear factor Y, subunit B3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Dusal.0433s00010.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|