PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Do029007.1

Organism

Dichanthelium oligosanthes

Taxonomic ID

888268

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium

Family

WRKY

Protein Properties

Length: 136aa MW: 14961 Da PI: 10.3366

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Do029007.1	genome	Dichan	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	103.6	1.1e-32	39	96	2	59
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 +Dgy+WrKYGqK vk+s+fprsYYrCtsa C vkk+ver++++p vv++tYeg+H h+ Do029007.1 39 EDGYRWRKYGQKAVKNSPFPRSYYRCTSAACGVKKRVERDRDEPGVVVTTYEGKHAHP 96 8********************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	2.1E-33	24	98	IPR003657	WRKY domain
SuperFamily	SSF118290	2.75E-28	30	98	IPR003657	WRKY domain
PROSITE profile	PS50811	31.204	33	98	IPR003657	WRKY domain
SMART	SM00774	9.4E-37	38	97	IPR003657	WRKY domain
Pfam	PF03106	3.0E-26	39	96	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 136 aa Download sequence Send to blast
MTTMAATAAH AAKPKKKKHR EPRELRFTFR TQSQVDQLED GYRWRKYGQK AVKNSPFPRS 60 YYRCTSAACG VKKRVERDRD EPGVVVTTYE GKHAHPCPAP ATGHLPPPLL LADGGRVARG 120 DAAAGCAQER AVDTSA

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	5e-29	29	99	8	78	Probable WRKY transcription factor 4
2lex_A	5e-29	29	99	8	78	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Do029007.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	FP098810	3e-87	FP098810.1 Phyllostachys edulis cDNA clone: bphyst005o12, full insert sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002279385.1	2e-43	PREDICTED: probable WRKY transcription factor 48
Swissprot	Q9FGZ4	6e-39	WRK48_ARATH; Probable WRKY transcription factor 48
TrEMBL	A0A1E5WN93	1e-95	A0A1E5WN93_9POAL; Putative WRKY transcription factor 48
STRING	VIT_05s0077g00730.t01	6e-43	(Vitis vinifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP2125	37	96

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G49520.1	2e-39	WRKY DNA-binding protein 48

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444]